KEGG   Brachyspira hyodysenteriae ATCC 27164: BHYOB78_04210Help
Entry
BHYOB78_04210     CDS       T04742                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bhd  Brachyspira hyodysenteriae ATCC 27164
Pathway
bhd00500  Starch and sucrose metabolism
bhd01100  Metabolic pathways
bhd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BHYOB78_04210
Enzymes [BR:bhd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BHYOB78_04210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth EBA-175_VI
Motif
Other DBs
NCBI-ProteinID: ANN63095
UniProt: A0A3B6VQD9
LinkDB All DBs
Position
complement(639480..642041)
Genome map
AA seq 853 aa AA seqDB search
MKLNKYMVSPSVPKELEPLIEITKNFWWCWNQKAVTLLRTIDIDNWDKRDHNPIRVLGES
LQERFDAMLQDDAAMMNLAEVYDEFKTYMNQETWYNSLNENQKTNNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPLVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVADRDITAQL
YGGNLETRIQQEILLGIGGVKALDKLGIKPTIYHMNEGHSAFLSLERIRQLMENNHLDKN
TAREVVFSSNIFTTHTPVPAGNDIFPIDMVQKYFTDYVKHIDMTMDEFIRLGRINPDDQK
ESFCMTVLALNLSAENNGVSELHGHVSRSMWKDIWKGVPVNELPIDSITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEYNIWERVQKIPDAELWRTHERRKERLIDFCRERLKTQITN
RGFTKNEIEHADQILSPEALTIGFARRFATYKRGTLLFRDLERLKKIVTNSERPVQIIFA
GKAHPHDNGGKELIRNIAEICRREDFRDHIVFIEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDGQNGWPIGNREEYTDLEYQDEVESKALYNVL
ENEIIPLFYDRGRDNIPRQWVAAMKWSMQTVCPVFSTNRMVADYFHKFYNNASKRYFNMT
ENEFAKAKELKAWKQDIASKWSKVLIENTISEMPSRNLKVGSKFEVKTIVNLGDIAPDSV
RVELYHGKLSMKEEIIDPITVEMKHSADLGNGRHSFSGTLECTDSGQSGYAIRMYPYHKD
LSYKFDMKLIIWS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataagtatatggtttcaccatcggttccaaaagaattagaaccacttata
gaaattactaaaaacttttggtggtgttggaatcagaaagcagtaactttattaagaaca
atagatattgataattgggataagagagatcataaccctataagggtattaggagaatct
cttcaggaacgttttgatgctatgcttcaagatgatgcagctatgatgaatttggctgag
gtttatgatgagtttaaaacttatatgaatcaagaaacttggtataatagcttaaatgaa
aatcaaaaaactaataatgaaaaaatagcttatttctcttttgaatacggacttcatgaa
tctttacctaactattctggaggtcttggtatattatctggagaccatttaaaatctgca
agcgatttgggtttgcctttagtagctgtaggacttttatatagaaaaggttatttcaga
cagtatttaaatgctgatggttggcagcaggaatatgatatagaaaatgatttctttaac
ttagctttagaaaaagttttagataaaaacggtgaaacaatgaaagttgatgttgatttg
cctggaagaaaagtttatgctcaaatctggaaagctaatgtaggaagaatagaactttat
tacttagatgctaatatagaagaaaatagtgtggcagacagagacattactgctcagctt
tacggcggtaacttagaaactagaatacagcaggaaatacttcttggtataggcggtgtt
aaagcattagataaattaggaattaaacctactatttatcatatgaatgaaggacacagt
gctttcctttctctagaaagaataagacaattaatggaaaataatcatttagataaaaat
actgcaagagaagttgtatttagctctaatatatttacaactcacactcctgtacctgct
ggtaatgatatattccctatagatatggttcaaaaatatttcactgattatgttaaacat
atagatatgaccatggatgaattcataagacttggaagaattaatccggatgatcaaaaa
gaaagtttctgtatgacagtacttgctttgaacttatctgctgaaaataatggtgttagt
gaacttcatggacatgtatcaagatctatgtggaaggatatttggaaaggcgttcctgtt
aatgaacttcctattgattctattactaatggtatacacactttaagctggatatctttt
gatatgcagaacttattagacagatatttaggacctcgttggagaactaagcctttagaa
tataatatttgggaaagagttcaaaaaatacctgatgcagaactttggagaactcatgaa
agaagaaaagaaagacttattgacttctgtagagaaagattaaaaactcaaataacaaac
agaggattcacaaaaaatgaaatagaacatgctgatcaaatactttctcctgaagcttta
acaataggttttgctagaagatttgctacttataaaagaggtacattgcttttcagagat
ttagagagattaaagaaaatcgttactaattctgaaagacctgtacaaataatatttgct
ggtaaagctcacccacatgataatggtggtaaagaattaattagaaatattgctgaaatc
tgcagaagagaagattttagagatcatatagtatttatagaagactatgatatcaatgtt
gctagatatatggttcaaggtgttgatgtatggcttaataaccctagaagacctttagaa
gcaagcggtacaagcggcatgaaagttccaccaaacggaggtttaaacttcagtgtatta
gacggatggtgggatgaagcttatgatggtcagaatggatggcctatcggtaacagagaa
gagtatactgatttagaatatcaagatgaagttgaaagtaaagctctttataatgtatta
gaaaatgaaataatacctctattctatgacagaggaagagacaatatacctagacaatgg
gttgctgctatgaaatggagtatgcagactgtttgtcctgtattctcaactaatagaatg
gttgctgattatttccacaaattctataacaatgcaagcaaaagatatttcaatatgact
gaaaatgaatttgctaaagctaaagaattaaaagcttggaaacaagatatagcttctaaa
tggtcaaaagttcttattgaaaacacaatttctgaaatgccttcaagaaatttaaaagtt
ggaagtaaatttgaagttaaaactatagttaatcttggagatatagcacctgattctgta
agagtagaactttaccatggtaagttaagcatgaaagaagaaatcatagatcctattaca
gttgaaatgaaacattcagctgatttaggaaatggaagacattctttctcaggaacttta
gaatgtactgacagcggacaaagcggttatgctataagaatgtatccatatcataaagat
ttaagttataaattcgatatgaaactcattatatggagctaa

DBGET integrated database retrieval system