KEGG   Bacteroides heparinolyticus: C3V43_01375Help
Entry
C3V43_01375       CDS       T05405                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bhf  Bacteroides heparinolyticus
Pathway
bhf00500  Starch and sucrose metabolism
bhf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C3V43_01375
Enzymes [BR:bhf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     C3V43_01375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C Big_5
Motif
Other DBs
NCBI-ProteinID: AVM56571
UniProt: A0A2R3MNK4
LinkDB All DBs
Position
complement(350260..352422)
Genome map
AA seq 720 aa AA seqDB search
MRNMKAICTKMACFLLVLMMSSAAMAESITSPNGQFKLNFSVNAQGEPVYELFYKGKNVI
NPSKLGLELKNDSGLMNGFTLANASTSTFDETWQPVWGEVKYIRNHYNELVVTLNQKVQD
RNMIIRFRLFNDGLGFRYEFPLQKNLNYFIVKEERTQFAMTGDHTAFWIPGDYDTQEYDY
TESKLSEIRGLMDEAITENSSQTQFSPTGVQTSLQMKTAEGLYINLHEAALVDYSCMHLN
LDDKNFVFESWLTPDAVGNKGYLQAPCTSPWRTVIVSDDARDILASKITLNLNEPCAYED
VSWIKPVKYVGVWWEMIAGKSSWAYTDDLPSIKLGETDYTKTKPNGRHGANNENVKKYID
FAARHGFDQVLVEGWNEGWEDWFGKSKDYVFDFVTPYPDFDIKMLNAYAKSKGVRLMMHH
ETSGSIRNYERHMDKAYQFMVDNGYNAVKSGYVGNMIPRGEHHYGQWLNNHYLYAVKKAA
DYKICVNAHEAVRPTGLCRTYPNLIANESARGTEYEAFGGSKPFHTTLLPFNRLIGGPMD
YTPGIFDTKLDFMGTLPHGQVQTTLAKQLALYVTLYSPLQMAADLVENYEKHMDAFQFIK
DVAVDWDDSKYIEAEPGDYITVARKAKGTNNWFVGGITDENARTATFTLDFLEPGKQYAA
TLYADGKDADYQANPTSYQIKKGIVTHKTKISVKEARSGGFALSLFEATSTDKKSLKKWK
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacatgaaagcaatctgcacaaaaatggcttgcttcctgctcgttttgatgatg
agtagtgcagcaatggcagagagtatcacctctcccaacggacaattcaaactgaacttt
tcggtaaatgcgcaaggcgaaccggtttacgagcttttttataaaggaaaaaatgtaatt
aacccttcaaaattaggattggaactgaagaacgattccggactgatgaacggttttaca
ctggccaacgcaagcacatctacatttgatgaaacgtggcaacctgtttggggtgaagtg
aagtacatccgtaaccactacaacgaattggttgtgacgcttaaccagaaagtgcaagac
aggaatatgattatccgcttccggttgtttaacgatggtcttggttttcgctatgaattt
cccttgcagaagaatctgaattattttattgtaaaagaagagcgtacacagtttgccatg
accggtgaccatacggcattttggattccgggcgactatgatacacaggaatacgattac
accgaatccaaactctccgagattcgtggattgatggatgaagccattaccgagaactct
tcacaaacgcagttttctccgaccggcgttcagacttccttgcagatgaaaactgccgaa
ggcttgtatatcaatctccatgaggcagctttggtagattactcttgcatgcatctgaat
ctggacgacaagaactttgtgtttgaatcttggttgacacctgatgctgtaggaaacaaa
ggctatttacaggcaccttgtacttcgccgtggcgcacggtgattgtcagcgatgatgcc
cgcgatattcttgcgtctaaaattacattgaacctgaacgagccttgcgcttatgaagac
gtttcatggattaaaccggtgaagtacgtgggcgtatggtgggaaatgatagccggcaaa
agttcttgggcatacacagatgacttgccttctataaaattgggcgaaacggattatacg
aaaaccaagcccaatggacgccatggagccaacaatgaaaatgttaagaagtacattgat
tttgcagccaggcatggcttcgaccaagtattggtagaaggctggaatgaaggttgggaa
gactggttcggtaaatcgaaagactatgtatttgactttgtgactccctatcctgatttt
gacatcaagatgctgaatgcttatgccaagagcaaaggcgtaagactgatgatgcaccac
gaaacttccggttccatacgcaactacgagcgacacatggacaaagcttatcaattcatg
gtggacaatggctacaatgccgtgaagagtggatacgtgggaaatatgattccccgtgga
gaacatcattacggacagtggcttaacaaccactatctctatgcagtgaagaaagcagcc
gattataaaatctgtgtcaacgcccacgaggctgtgcggcctaccggtttgtgccgtaca
tatcccaacctgattgctaatgagtcagcgcgcggtactgaatacgaagcattcggtggc
agtaagccgttccataccacgctgttgccgttcaatcgtcttattggtggcccgatggac
tacacaccgggcatattcgacacgaaacttgactttatgggtactctgcctcacggacaa
gttcagaccacccttgccaaacagttggctctttacgtcaccctttacagtccgttgcaa
atggctgccgacttggtggagaactacgaaaagcacatggatgcttttcaattcatcaaa
gacgttgcggtagattgggatgacagcaagtatatagaggcagaaccgggtgactacatc
accgtagcccgtaaagcaaaaggcacaaacaattggtttgtaggcggcatcacggatgag
aatgcgcgtaccgccacttttacgcttgatttcttggagccgggtaagcagtatgcggct
accctctatgcggacggtaaagatgcagactaccaagcaaatcccacctcttatcaaatc
aaaaaaggcattgtgacccataagaccaagatatctgtgaaagaagcacgcagcggcggt
ttcgccctgagtttgtttgaagccacttccacagataaaaagtcactgaaaaaatggaaa
tga

DBGET integrated database retrieval system