KEGG   Bacteroides heparinolyticus: C3V43_08605Help
Entry
C3V43_08605       CDS       T05405                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bhf  Bacteroides heparinolyticus
Brite
KEGG Orthology (KO) [BR:bhf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C3V43_08605 (ahpF)
Enzymes [BR:bhf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C3V43_08605 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 GIDA HI0933_like Thioredoxin_3 FAD_binding_2 DAO AlaDh_PNT_C FAD_oxidored NAD_binding_7 Thi4 NAD_binding_8 Glutaredoxin FAD_binding_3 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AVM57810
UniProt: A0A2R3MS86
LinkDB All DBs
Position
complement(2097965..2099524)
Genome map
AA seq 519 aa AA seqDB search
MLDTTILEQVRSVFRHLQARYVFHASHSPKHEKSRELIDFLNDVAGCSDKLSCRLTEVDK
PVLEFSLMKEEAETGIRFRGIPGGHEFTSLLLAVLNADGKGKNLPDETIVRRIKALKGPI
DLKTYVSLTCTNCPDVVQALNVIALLNPDVTHEMVDGDAYQEEVNALKIQAVPSVYANGK
PLHVGRGSLGQLLQKLEEAFGSLPQADAIPVERTFDVLVLGGGPAGASAAIYSARKGLRV
AVVAGRIGGQVKETVGIENLISVPQTTGAQLADALRNHIGHYPIELFEDRQIEKAELQGK
TKRISVTGGETFIAPAVIIATGAGWRKLNVEGEAEYIGRGVAFCPHCDGPFYQGKHVAVI
GGGNSGIEAAIDLAGICRKVTVFEFADTLKADQVLQAKARSLPNVEIFTSSQTTKVVGNG
EKVTAIRVKDRLTGEERDFPLDGIFVQIGLSANSLPFRDALETTPIGEIKIDAFCRTSLP
GVYAAGDVSSVPYKQIVIAMGEGAKAALSAFDDRIRGLC
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttagatacaactattttagagcaagtgcggagcgtattccggcatttgcaagcccgt
tacgtctttcacgccagccactcgccgaagcacgagaagagccgggagctaatcgacttt
ctgaatgatgtggccggctgttccgacaaactttcctgccgattgaccgaagtcgacaag
cccgtgcttgagttttctcttatgaaagaggaagcggaaacgggcatcaggtttcgcggc
ataccgggcgggcatgaattcacctcactcctgctggctgtgctgaatgccgacgggaaa
ggcaaaaatctgccggatgagaccatcgtccgccgcatcaaggccttgaaaggccccatc
gacctgaaaacttacgtatcgctgacgtgcaccaactgtcccgatgtggtgcaggcgctc
aacgtcattgctttgctgaatccggatgtgacgcacgagatggtggacggagatgcttat
caagaggaagtgaatgcattgaagatacaggccgtgccatcggtttatgccaatggaaag
ccgttgcacgtgggacgcggctcgttaggccaattgttgcaaaagttggaagaagccttc
ggaagcctgccgcaagccgatgcaatccctgtcgaaaggacattcgatgtgctcgttctc
ggtggaggtcctgccggggcctcggcagccatctattctgcccgcaaggggctgcgtgtg
gcggtcgttgccggacggataggcggacaggtgaaagagaccgtgggcatcgaaaacctg
atttccgtgccgcaaaccacgggcgcgcaactggccgatgcactcagaaaccacatcgga
cactatccgatagaactgtttgaagaccggcagatagagaaggcagagctgcaaggcaag
acgaagcgcatctccgtgacgggaggcgaaacattcattgctcccgcagtaatcattgcc
acgggtgccggatggcgcaagctgaatgtagagggcgaggccgaatacatcggtcgtggc
gtggctttctgtccgcactgcgacggcccgttctatcagggaaagcacgtggccgtgatt
ggcggaggcaactccggcatagaagccgccatcgacttggcaggtatctgccggaaggtt
accgtattcgagtttgccgatacgctgaaggccgaccaagtgcttcaggcaaaagcccga
agcctgccgaacgtggaaatcttcacctcctcgcagaccacgaaagtggtgggtaatggc
gaaaaggtgacagccatccgcgttaaagaccgccttacgggcgaggaacgcgactttcct
ctggatggcatcttcgtgcagataggcctctcggccaatagcctcccctttcgtgatgcg
ttggagaccactcccatcggagaaatcaagatagacgccttttgccgtacctcgcttccg
ggtgtttatgcagccggcgatgtgtcgagtgtgccctacaagcaaattgtcattgccatg
ggcgaaggagccaaagcggcactttcggcgttcgacgaccgcatccgggggctctgctga

DBGET integrated database retrieval system