KEGG   Bacillus horikoshii: B4U37_00650Help
Entry
B4U37_00650       CDS       T04904                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bhk  Bacillus horikoshii
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bhk03012]
    B4U37_00650
   03029 Mitochondrial biogenesis [BR:bhk03029]
    B4U37_00650
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bhk04147]
    B4U37_00650
Translation factors [BR:bhk03012]
 Eukaryotic Type
  Elongation factors
   B4U37_00650
 Prokaryotic Type
   B4U37_00650
Mitochondrial biogenesis [BR:bhk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B4U37_00650
Exosome [BR:bhk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B4U37_00650
  Exosomal proteins of breast cancer cells
   B4U37_00650
  Exosomal proteins of colorectal cancer cells
   B4U37_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Peptidase_U32_C
Motif
Other DBs
NCBI-ProteinID: ART74668
UniProt: A0A1Y0CH96
LinkDB All DBs
Position
131748..132938
Genome map
AA seq 396 aa AA seqDB search
MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKKSGKGAAMAYDMIDAAPEERER
GITISTAHVEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREH
ILLSRQVGVPYLVVFLNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDVPVIKGSALKAL
EGDAEWEERIVELMAAVDDYIPTPARDTEKPFMMPVEDVFSITGRGTVATGRVERGQVKV
GDTIEIIGLTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVARDDIQRGQVLAKPGT
ITPHTKFKAEVYVLSKEEGGRHTPFFTNYRPQFYFRTTDVTGICNLPEGIEMVMPGDNVE
MTVELISPIAIEEGTKFSIREGGRTVGAGVVATIQE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagagaaattcgatagatccaagactcatgctaatatcggtacaatcggtcac
gttgaccacggtaaaacaactttaacagctgcaatcacaactgttcttgctaagaagagc
ggtaaaggtgctgcaatggcatacgacatgatcgatgctgctccagaagaaagagagcgt
ggaatcacaatttctacagctcacgttgagtacgaaactgacaaccgtcactatgcacac
gttgactgcccaggacatgctgactatgttaaaaacatgatcactggagctgctcaaatg
gacggcggaatcctagtagtatctgctgctgacggcccaatgccacaaactcgtgagcac
atccttctttctcgtcaagtaggtgtaccttacctagtagtattcttaaacaaatgcgac
atggtagacgacgaagaattattagaattagttgaaatggaagttcgtgaccttctttct
gagtacgatttccctggagacgatgttcctgtaatcaaaggttctgctcttaaagctctt
gaaggagacgctgagtgggaagaaagaatcgttgagcttatggctgcagttgatgactac
atcccaacaccagctcgtgacactgaaaagccattcatgatgccagttgaggacgtattc
tctatcactggtcgtggaacagttgctactggacgtgttgagcgtggacaagttaaagtt
ggtgacactattgaaatcatcggtttaactgaagagcctaaatctactactgtaactgga
gtagaaatgttccgtaagcttcttgactatgctgaagctggagacaacatcggtgcactt
cttcgtggggttgctcgtgacgacatccaacgtggacaagtattagctaagcctggtaca
atcactccacacacaaagttcaaagctgaagtttatgtactatctaaagaagagggtgga
cgtcacactccattcttcacaaactaccgtcctcagttctacttccgtacaactgacgta
actggtatttgtaacctacctgaaggcatcgaaatggttatgcctggcgacaacgttgag
atgactgttgaacttatctctccaatcgctatcgaagaaggaactaagttctctattcgt
gaaggtggacgtactgtaggcgctggcgtagtagcgactatccaagagtaa

DBGET integrated database retrieval system