KEGG   Bacillus horikoshii: B4U37_01385Help
Entry
B4U37_01385       CDS       T04904                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00473  D-Alanine metabolism
bhk00550  Peptidoglycan biosynthesis
bhk01100  Metabolic pathways
bhk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    B4U37_01385
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    B4U37_01385
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    B4U37_01385
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhk01011]
    B4U37_01385
Enzymes [BR:bhk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     B4U37_01385
Peptidoglycan biosynthesis and degradation proteins [BR:bhk01011]
 Precursor biosynthesis
  Amino acid ligase
   B4U37_01385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST RimK GARS_A ATPgrasp_YheCD ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ART74794
UniProt: A0A1Y0CIC9
LinkDB All DBs
Position
263717..264811
Genome map
AA seq 364 aa AA seqDB search
MKTKLHLLYGGKSAEHQVSLQTALAVTKALDTDKFEVYPLYITETGEWKRGGLLNGPAES
VHQLKLEEGGTTIAPLALTNEEETEETQTVVFPLLHGPNGEDGTVQGMLELLNLPYVGNG
VLASSAGMDKVIMKNLFDQAGLPQVGYAHFLRSEWEKAADTTYEKVESELGYPCFVKPAN
LGSSVGISKAKNRKELEAAFREAFDYDRKIIVEQGLEGAREIEIGVLGNDEPECSVIGEI
APKTEFYDYKAKYEDGDTAMIIPAEISEDIYEQVKEMAITAFKAIDGAGLVRADFFLTKE
GKLYINEVNTMPGFTPFSMFPLLWQHTDVSYPQLIEKLVGYAQQRHEEKQKIKHTFKKKI
SPVD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaaattgcatttattatatggcgggaaatcagcggaacaccaagtttccttg
caaacagcattagctgtaacaaaggctttagatacagataaatttgaagtatatccgtta
tacataacggaaacaggagaatggaagcgcggtggcttgttgaatggaccggcagagagc
gtacaccaactgaagctggaagagggcggcacaaccatcgcacctcttgcattgacgaac
gaagaagaaacggaagagactcaaacagtcgtgttcccactattacatggcccgaacggg
gaagacggaacagttcaaggaatgttggaacttttaaaccttccttatgtaggaaacggt
gtgttggcatcatctgctggaatggataaagttatcatgaaaaaccttttcgaccaagca
ggattgccacaagttggctatgcacacttccttcgttctgaatgggaaaaggctgcagat
acaacatatgaaaaagtagaatcagagcttgggtatccatgctttgttaagcctgcaaac
ttagggtccagtgttgggatcagtaaagcgaaaaaccgcaaagaattggaagcggctttc
cgtgaagcgttcgactatgatcgcaaaatcatcgtggaacaaggtttggaaggtgcccgt
gaaatcgagattggcgtacttggtaacgacgagccggaatgctcggtgattggagaaatc
gctcctaagacagagttttacgactacaaagcaaagtatgaagatggcgatacggccatg
atcatccctgcggagatcagtgaagacatctatgagcaagtaaaagaaatggccatcact
gcttttaaagcaattgatggagcaggccttgtgcgcgcagatttctttttaacaaaagag
ggtaaactgtacatcaacgaagtaaacacaatgccaggtttcacgccattcagcatgttc
ccattattatggcagcatactgatgtgtcctacccacaactaatcgaaaaactagtagga
tacgcacaacaacgccacgaagaaaaacaaaaaatcaagcatacatttaaaaaaaagatt
tctcctgtagattga

DBGET integrated database retrieval system