KEGG   Bacillus horikoshii: B4U37_06150Help
Entry
B4U37_06150       CDS       T04904                                 

Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00730  Thiamine metabolism
bhk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    B4U37_06150
Enzymes [BR:bhk01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     B4U37_06150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 HI0933_like GIDA FAD_binding_3 GDI Thi4 Pyr_redox_3 FAD_oxidored Pyr_redox Lycopene_cycl 3HCDH_N ApbA
Motif
Other DBs
NCBI-ProteinID: ART75634
UniProt: A0A1Y0CKP2
LinkDB All DBs
Position
1169222..1170352
Genome map
AA seq 376 aa AA seqDB search
MNKIYDVIIIGGGVNGCSIAYYLAGEGRSVLLLEREKLAGKASSAAAGMLGAQVEVTEEG
ALFDIAKESRAMFPSLQYELKEHSGIDIELVQKGMLKLAMNEEEARHLKSTIDFQQKLGE
RAEWLAPEQVKKREGQLSDALVGAMDIPMDGHVNPERLTHAFAKSAVNLGAEVKEYVEVY
SLLMDGSNVKGVETSNGTFHGENVVVAAGAWSKRVLGECGVTVPAYPVKGECFSVITDRP
LLASTIFTESCYLVPKSGNRLVIGATMIPDTFSENVTVGGLFQLMGEAARVLPALKSATF
ERSWSGIRPQTGDSLPYLGQHPKYKNLVIATGHYRNGILLSPITGKHVTKMIHGEPMPVY
IEAFKLDRLKEYARGE
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaatctatgacgtaattattatcggtggtggtgtcaacggctgttccattgcg
tactatcttgccggtgaaggaagaagtgtattgcttttggaaagggaaaagttggcgggt
aaggcatcgagtgcagctgccggcatgcttggagcacaagtggaagtgacggaagaagga
gcactttttgatatcgccaaggaaagtagggcgatgtttccctctcttcaatacgaattg
aaagagcactcgggaatcgacatagaacttgtgcagaaaggaatgctgaagcttgccatg
aatgaggaagaggcacggcatctaaaaagcacgatagactttcaacagaagttaggggaa
cgggcagagtggcttgccccagaacaagtaaagaaaagggaggggcaattatcggatgca
ctggtaggggctatggatattccaatggatgggcatgtgaacccagaacgccttactcat
gcatttgcaaaatcggcagtcaatcttggagcggaagtgaaagagtatgtagaggtgtac
tcgctactgatggatgggagtaacgttaaaggtgtcgaaactagcaacggaacgtttcat
ggagaaaatgtagtcgttgctgcaggagcctggagtaaaagggtgcttggggagtgcggc
gtgacagttcccgcatatccggtaaaaggggagtgcttctctgtcatcacagaccgccca
ttgctcgcaagtactatttttacagaaagctgttatcttgttccgaaaagtggaaacagg
ctggttatcggagccacgatgatccctgatactttttccgagaatgttacggtaggtggg
ctttttcagttaatgggggaagctgccagagtgcttccggctttgaagagtgctacattt
gagaggtcttggtcaggtatacgcccgcaaacgggggatagtcttccttatctggggcag
catccgaaatataagaatcttgtcatcgctactggacattatcgaaatggaatcctacta
tcccctatcacaggaaaacatgtaacaaaaatgattcatggtgagcccatgcctgtttat
atagaagcattcaagttagatagattaaaagaatatgcaaggggtgagtag

DBGET integrated database retrieval system