KEGG   Bacillus horikoshii: B4U37_13110Help
Entry
B4U37_13110       CDS       T04904                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bhk  Bacillus horikoshii
Brite
Enzymes [BR:bhk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     B4U37_13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ART76926
UniProt: A0A1Y0CPK9
LinkDB All DBs
Position
complement(2554168..2555058)
Genome map
AA seq 296 aa AA seqDB search
MIKQNQLVFKQFLSDVEDWCLEILTSNQGSKEDSRSSWLSEIRGILKRVQHAQEQQYIYE
SDILDIKRCVEKTAEGMRNVSGSRVNNGRVPIGQHTLPPLPYPYNALEPYISREIMELHH
QKHHKSYVDGLNKAEMKMLEARETGDFDLIKHWEREAAFHGSGHYLHTMFWDNMSPNGGG
HPSGRLMQQIVQDFGSYEKFKKHFSEAADKVEGVGWALLVWSPRAHRLEILQTEKQQLFT
QWDTIPLLGLDVWEHAYYLQYKNNRKDYIDKWWNLVNWKDVEKRYQEASRLKWKPY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaacaaaatcagcttgtttttaagcagtttttaagcgatgtggaagactggtgt
ttagaaatattgacgtccaaccaaggtagcaaagaagattctcgcagcagttggttatcc
gaaataagagggattctaaaaagggttcaacatgcacaagaacaacagtatatttacgag
tctgacatattagatattaaaaggtgtgtggaaaagaccgcagaagggatgcgtaatgta
tcaggtagccgagtgaataatggaagggtgccgataggtcagcatacccttccaccattg
ccatatccatataacgcccttgaaccatacatttcaagggagataatggagttgcaccac
caaaagcatcataaaagctatgtggacggtttaaataaagcggaaatgaagatgttagag
gcgcgtgaaacaggtgactttgatctaatcaagcattgggaacgtgaagcggcgtttcat
ggctcgggtcattatttgcatacgatgttttgggataatatgtcccctaatggtggagga
catccaagcggaaggctaatgcagcagatagttcaggactttggtagttatgagaaattt
aaaaaacatttttcagaagctgcggacaaagtggaaggtgttggttgggctttgcttgtt
tggtcaccgcgtgcacaccgattggaaattttgcaaacagagaagcagcagctgtttact
caatgggatacgattcccttacttggtttagatgtttgggagcatgcttattatcttcaa
tataaaaataaccgcaaagattatattgataagtggtggaatcttgttaattggaaagac
gttgaaaagcgctaccaagaagcgtcaagattgaagtggaaaccatactga

DBGET integrated database retrieval system