KEGG   Bacillus horikoshii: B4U37_15815Help
Entry
B4U37_15815       CDS       T04904                                 

Definition
(GenBank) protein translocase subunit SecDF
  KO
K12257  SecD/SecF fusion protein
Organism
bhk  Bacillus horikoshii
Pathway
bhk02024  Quorum sensing
bhk03060  Protein export
bhk03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    B4U37_15815
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    B4U37_15815
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    B4U37_15815
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bhk02044]
    B4U37_15815
Secretion system [BR:bhk02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   B4U37_15815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SecD_SecF Sec_GG MMPL
Motif
Other DBs
NCBI-ProteinID: ART77427
UniProt: A0A1Y0CRD0
LinkDB All DBs
Position
complement(3054469..3056718)
Genome map
AA seq 749 aa AA seqDB search
MVKRGRIAAFFLLLILIGSTIGVFTNPITKDIKLGLDLQGGFEVLYEVKPINENSEVDRD
LLVSTVSALYKRVNVLGISEPNIQIEGDDRIRVQLAGVEDQSKARELLSTEAKLSFRDVD
DKLLMDGSALAEGGASQSFDQNNAPSVALTLRSASEFADITRQVRDMGVGRNLMVIWLDF
EEGVDSYEAEAGKEDPKYLSAAQVTQVLNETNVQITGNFSIESAKELAELLKAGSLPVEL
EEIYSTSVGAKFGETALQKTVLAGIIGVSAILIFMLVYYRLPGLVAVVTLSTYIFLILLV
FELMNGVLTLPGIAALILGVGMAVDANIITYERIKEELKLGRSAMSAFRAGSRNSFSTIL
DANLTTLLAAGVMFVYGTSSVKGFATMLIVSILLSFITAVFGSRLLLGLWVNSRFMNNKP
HLFGVKKEDILDINMTDENTEPPNRFENWDFLKHRKKFFMLSGALIVAGIIVLAVFRLNL
GIDFASGTRVEILSETSLTAEEITEELASIGLEPKDVVLAGNDNEIAVARYVDDFSQTEI
AEVKEYVQNKYGSEPSVSTVSPTVGQELARNAFFAILIAAVGIIIYVTIRFEWMFALAAI
VALFHDAFFIVSFFSLTRLEVDITFIAALLTIVGYSINDTIVTFDRIRENLKKKKRVKTY
EDLEEIVNKSLQQTFVRSINTVGTVVIAVIALLIFGSESITNFSIALLVGLIVGTYSSLF
IAAQLWMKWKYKQISRPKKASVEDPEPEV
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaaagaggacggatagcagcattctttttacttctaattctaattggaagcaca
attggagtgtttacgaatccaattacaaaagatattaaacttggtcttgatcttcaaggg
ggctttgaggtcctctatgaagtaaaacctatcaatgaaaatagtgaagtggatcgtgat
ttgcttgtaagtacggtcagtgccctttataaaagggtaaacgttttagggattagtgag
ccgaacattcaaatcgaaggcgatgaccgtatccgtgtccagcttgccggagtggaagac
cagtccaaggcaagggaacttctatccacagaagcaaaattatccttccgtgatgtggat
gacaagttactaatggatggttcagcactagcagaagggggagcaagtcagtcctttgac
caaaacaacgctccaagtgtggctctgacgcttcgttctgcttctgaatttgctgatatt
acccgtcaggtccgcgatatgggtgttgggcgcaacctgatggttatttggttggatttt
gaagaaggtgtggattcatatgaagccgaggctggaaaagaggatcctaaatatctttcc
gcagcccaggtaacacaggtattaaatgaaacaaacgtgcagattacagggaacttttcc
attgaatctgctaaagagcttgccgagctattgaaagcagggtccttacctgttgaattg
gaagaaatctattccacgtctgtaggtgctaaattcggggaaactgcacttcagaaaacg
gttcttgcaggaattattggtgtaagtgctatcttgattttcatgcttgtatactaccgt
ttgccaggccttgtggcggttgtcaccttgagtacgtatatattcttaattctgctagtg
tttgaattgatgaatggggtacttaccttgcctggtattgccgcgttgatacttggtgta
ggtatggcagttgatgccaatattatcacctatgaacgaattaaagaagaattaaaactt
ggcagatctgccatgtctgccttccgtgcaggaagcagaaactcgttttcaaccattttg
gatgccaacttgactacgctccttgcagcaggtgttatgttcgtttatggaacaagctct
gttaaaggatttgcgacgatgttgattgtgagtatcctattgagcttcattaccgctgtt
tttggttcaagactattgcttggcctgtgggtgaacagcagatttatgaataataaacca
catctattcggtgtgaaaaaagaagatatccttgatatcaatatgacagatgaaaatacg
gagccacctaaccgatttgaaaattgggatttcttgaagcatcgtaaaaagttctttatg
ctttcaggtgctttgattgttgccgggattatagtgcttgctgtcttccgcttgaacctt
ggaattgattttgctagtggaacaagggtagaaattttaagtgagacaagcctgacagct
gaggaaattacagaagaactggcttccattggtttagaaccaaaagatgtggttcttgca
ggaaatgataatgaaattgctgttgcaagatatgtggatgatttttcacaaacagagata
gcggaagttaaagagtatgtgcaaaataaatacggctcggaaccaagtgttagcacggtt
tctccaactgttggtcaagaacttgcaaggaatgctttctttgccattctgatagcggct
gttggaatcatcatctatgtaaccatccgatttgaatggatgtttgcacttgctgccatt
gtggcattgttccatgacgctttctttattgtatcgttcttcagtttaacaagactagaa
gtggatatcaccttcattgcagccctgttgaccattgtcggttactcgatcaatgatacg
atagttacgtttgaccgaatccgtgagaatctgaaaaagaaaaagcgggttaaaacatat
gaagaccttgaagaaatcgtgaataagagtttgcaacaaaccttcgttagatctatcaat
accgtagggactgttgtaattgcggttatcgctttgcttattttcggcagtgagtcgatt
accaacttctccatcgcgttattggtagggttgattgtcggtacgtattcttctttattc
attgcagcacagctatggatgaaatggaaatacaaacaaattagtagacctaaaaaagct
tctgtagaagatccggagccagaagtataa

DBGET integrated database retrieval system