KEGG   Bacillus horikoshii: B4U37_15855Help
Entry
B4U37_15855       CDS       T04904                                 

Definition
(GenBank) hypothetical protein
Organism
bhk  Bacillus horikoshii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2905
Motif
Other DBs
NCBI-ProteinID: ART77433
UniProt: A0A1Y0CQ14
LinkDB All DBs
Position
complement(3063339..3063536)
Genome map
AA seq 65 aa AA seqDB search
MELPKMLMVAGAVLLIVGFLWQVVGKIPGDIVVKKGNVTFFFPIVTSIIISIVLSLIFYF
IGRFR
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcctaaaatgctgatggtagctggagcagtacttttaatcgtcggattcctc
tggcaagtagtcggaaaaatcccaggagacatcgtcgtcaaaaaagggaacgtaacattc
ttcttcccaatcgtaacctccatcatcatcagcatcgtactcagtctaatattttatttc
atcggccgatttagataa

DBGET integrated database retrieval system