KEGG   Bacillus horikoshii: B4U37_16610Help
Entry
B4U37_16610       CDS       T04904                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00020  Citrate cycle (TCA cycle)
bhk00480  Glutathione metabolism
bhk01100  Metabolic pathways
bhk01110  Biosynthesis of secondary metabolites
bhk01120  Microbial metabolism in diverse environments
bhk01130  Biosynthesis of antibiotics
bhk01200  Carbon metabolism
bhk01210  2-Oxocarboxylic acid metabolism
bhk01230  Biosynthesis of amino acids
Module
bhk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bhk_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B4U37_16610
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B4U37_16610
Enzymes [BR:bhk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     B4U37_16610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ART77576
UniProt: A0A1Y0CRK2
LinkDB All DBs
Position
complement(3236849..3238117)
Genome map
AA seq 422 aa AA seqDB search
MTQGTKITVTDGVLNVPNNPIIPFIEGDGIGPDIWASASRVLEAAVEKAYNGEKEIVWKE
VLAGEKAFNQTGEWLPSQTLDDIREYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVRYFQGVPSPIKRPEDTDMVIFRENTEDIYAGIEYAKGSAEVEKLINFLQTEMGVNKIR
FPETSGIGIKPVSEEGTSRLVRGAINYAIEHGRKSVTLVHKGNIMKFTEGAFKNWGYELA
EKEFGDKVFTWAQYDRIAEAEGKDAANKAQEAAEAEGKILVKDSIADIFLQQILTRPKEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWTEAAKLVVDAMEKSIASKVVTYDFARLMDGATEVKCSEFGDELIK
NM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
ttgacacaaggaacaaaaattacagttacagatggcgtactaaacgtacctaacaacccg
attattccattcatcgagggagacggaattggtcctgacatttgggcatctgcatcccgt
gttttagaagcagctgttgaaaaagcatataatggtgaaaaggaaattgtctggaaagaa
gtattggctggagaaaaagcattcaaccaaactggtgaatggttaccaagtcaaacactt
gatgatatccgtgagtacataattgcaatcaaaggaccactaactactccagttggtgga
ggaatccgttctcttaacgttgctttacgtcaagagttggaccttttcacttgcttacgt
cctgttcgttacttccaaggagttccttctcctattaaacgcccagaagatacggatatg
gttattttccgtgaaaacacagaagatatctatgctggaatcgagtacgcaaaaggttct
gcggaagtagaaaagctaatcaatttccttcaaacagaaatgggagttaacaaaattcgc
ttccctgaaacttccggtatcggaatcaagcctgtatctgaagaaggtacttcccgtctt
gtacgtggtgcaatcaactatgcaatcgagcatggccgcaaatctgtaacactagtacac
aaaggaaacatcatgaagttcactgagggtgctttcaaaaactggggttacgagctagct
gaaaaagaattcggcgataaagtattcacttgggcacaatatgaccgtatcgcagaagcg
gaaggtaaagatgctgcaaacaaagcgcaagaagctgcagaagcagaaggcaaaatccta
gtgaaggattccattgctgatatcttcttacaacaaatccttactcgtccaaaagagttc
gatgttgttgcaacaatgaacctgaacggtgactacatttctgatgcacttgctgcacaa
gtaggcggaatcggaatcgctcctggagcaaacatcaactatgaaactggtcacgcaatt
ttcgaagctacacatggtacggctccgaaatatgctggtcttgataaagtaaacccatct
tctgttatcctttccggtgtattaatgcttgagcaccttggttggacagaagctgctaaa
cttgtagtagatgctatggaaaaatccatcgcttctaaagtagtaacttacgactttgca
cgtctaatggacggcgcaacagaagtaaaatgctccgagtttggcgacgaactaatcaaa
aacatgtaa

DBGET integrated database retrieval system