KEGG   Bacillus horikoshii: B4U37_18590Help
Entry
B4U37_18590       CDS       T04904                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K07516  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00071  Fatty acid degradation
bhk00362  Benzoate degradation
bhk00650  Butanoate metabolism
bhk01100  Metabolic pathways
bhk01120  Microbial metabolism in diverse environments
bhk01200  Carbon metabolism
bhk01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    B4U37_18590
  09103 Lipid metabolism
   00071 Fatty acid degradation
    B4U37_18590
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B4U37_18590
Enzymes [BR:bhk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     B4U37_18590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 ApbA NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ART77917
UniProt: A0A1Y0CSP3
LinkDB All DBs
Position
complement(3614552..3616936)
Genome map
AA seq 794 aa AA seqDB search
MKQSIKKAAVIGSGVMGSGIAAHLANVGIPTILLDIVPNKLTSEEEQKGLTLSDKAIRNK
FTNTAVQKLLKQKPAPLTSKSNLALIEAGNLEDDIAKIADCDWVIEVIVENLEIKKQLFE
KVDAHRKPGSIISSNTSGISIEAMAEGRSEDFKKNFLGTHFFNPPRYLKLLEVIPTKDTS
HEVVSFIKTFGEDVLGKGIVLAKDTPNFIANRIGTYGLLVTVNEMLEGGYSVGEVDSVTG
PAIGRPKSATFRTLDVVGLDTFIHVANNVYEKVEGKEQEVFRIPDFMNKMKEKGWLGSKS
GQGFFLKKGKEILELNPETLEYDARKKLKTPALEMSKQAKGYSNKMKALVYADDRAGNLI
WSILAPVLSYSAELLGEIADDIVAIDQAMKWGFGWDHGPFETWDAIGLEESVLKMKEDGI
AVPKWVDEMLANGHRSFYQKDGGTTLFYDNGTYKALEVNPKVVHLKTLKETKGVIKKNSG
ASLIDLGDDVALLEFQSPNNAIGLDIIQMVNYALEEVDKNYKGLVVGNQGKNFCVGANLA
MILMEAQDDNYFEIEMVVKHFQQAMMNIKYSSKPVVAAPFGMTLGGGTEICLPTSQLQAS
SETYMGLVEVGVGLIPGGGGNKELYMKHLSSMPQGLEFDLQKVANKVFEQIATAKVSTSA
AEARDLHLLNNKDQISFNGDHLIHDAKQAVTSLYDAGYTAPVRRKVPVVGETGYATLMLG
AHNMQYSGFISEHDLKIAKKLAYVIAGGNVPFGTEVDEQYLLDLEREAFLSLVGEAKSQQ
RMQHMLVKGKPLRN
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaagtattaaaaaggctgctgtaatcggatcgggagttatgggatccggcatt
gccgcacacttagcaaacgttggaattcctacaatcttgttagatatcgttcctaacaaa
ttaacgagtgaagaagaacaaaagggcttaacactctctgataaagcaatccgaaacaaa
tttaccaatacagcagtacaaaagttattaaagcaaaaaccagctccacttacatccaaa
tctaatcttgctctaattgaagcaggaaacctagaggatgatattgcgaaaattgcagat
tgtgactgggtcattgaagtaatcgttgaaaacctagaaatcaaaaagcaactattcgaa
aaggtagatgcacaccggaaaccaggaagcatcatcagttccaacacatctggtatttcc
attgaagcgatggcggaaggacgttcggaagacttcaaaaagaactttcttggaacgcat
ttctttaacccaccgcgttatttgaaattgcttgaagtgattccaactaaagacacaagt
cacgaagttgttagcttcattaaaacgtttggtgaagatgtgttaggaaaaggcatcgta
cttgcaaaagatacgccaaacttcattgcaaaccgcatcggaacgtatggcttacttgtt
acagtaaatgaaatgcttgagggcggctatagtgtcggggaagtggattctgttactggt
cctgcaatcggcagaccgaagagcgcaacattccgtacacttgacgtggtaggcttggat
acattcatccatgtggccaacaatgtttatgaaaaagtagagggcaaggaacaagaagta
ttccgcattcctgactttatgaacaagatgaaggaaaaaggctggttgggctccaagtcc
ggtcaaggtttcttcttgaaaaaagggaaagagattctagaacttaacccagaaacatta
gaatatgatgcacgtaaaaagttgaaaactcctgctcttgaaatgagcaaacaagcaaaa
ggttacagcaataaaatgaaagcgcttgtatatgcggacgaccgtgcaggaaatcttatc
tggagcattcttgcaccagtgttaagctattccgctgaattattaggtgagatcgcagat
gatatcgtggcaattgaccaagcgatgaaatggggcttcggctgggatcatggaccattt
gaaacttgggatgccatcggtttagaagaatcggtcctgaaaatgaaagaggatggaatc
gctgttccgaaatgggtcgacgaaatgctagcgaacggtcatcgttctttctaccaaaaa
gatggcgggaccacgctgttttatgacaacggtacttacaaagcgctagaagtaaacccg
aaagttgtacacttaaaaactctcaaagaaacaaaaggtgttatcaagaaaaactcaggt
gcaagcttaatcgatcttggagacgatgtggcactacttgagttccaatctccaaacaat
gcgattggccttgatatcattcagatggtgaattacgcgctcgaagaagtggacaaaaac
tataagggacttgttgtcggaaaccaaggaaagaacttctgtgtaggtgcaaaccttgcg
atgattctgatggaagcacaagacgacaattattttgaaatagaaatggttgtgaagcac
ttccaacaagccatgatgaatattaaatacagttccaagccggttgtggctgctccattt
ggcatgacactcggtggaggaacagaaatctgcctgccgacaagccaactgcaggcatcc
agtgaaacgtatatgggccttgtagaagtcggagtcggattgatccctggtggaggcgga
aataaagagctttacatgaagcatttaagcagcatgccacaaggccttgaatttgacctg
caaaaggttgcgaacaaagtattcgaacaaattgcgacggcaaaagtctctacttctgca
gcggaagcaagagatctgcacttgctgaataataaagatcaaatcagcttcaacggggac
cacctgattcatgatgcaaagcaggcggtaacaagcctatatgatgcaggctacacagca
cctgttcgcagaaaagtccctgtagtgggggaaacaggctatgcaaccttaatgcttgga
gcacacaatatgcaatactccggattcatttccgagcacgatttaaagatcgctaaaaag
cttgcctacgttatcgcaggcggaaatgtaccgtttggaacagaagtagatgaacagtac
ctactagaccttgagcgcgaagcattcctaagcctagttggagaagcaaaatcccaacaa
cgcatgcaacacatgcttgtaaaaggaaagccattacgtaactaa

DBGET integrated database retrieval system