KEGG   Bacillus horikoshii: B4U37_18950Help
Entry
B4U37_18950       CDS       T04904                                 

Definition
(GenBank) imidazole glycerol phosphate synthase subunit HisF
  KO
K02500  imidazole glycerol-phosphate synthase subunit HisF [EC:4.3.2.10]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00340  Histidine metabolism
bhk01100  Metabolic pathways
bhk01110  Biosynthesis of secondary metabolites
bhk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    B4U37_18950
Enzymes [BR:bhk01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.10  imidazole glycerol-phosphate synthase
     B4U37_18950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus TMP-TENI ThiG IMPDH G3P_antiterm DHO_dh DUF561
Motif
Other DBs
NCBI-ProteinID: ART77984
UniProt: A0A1Y0CSJ5
LinkDB All DBs
Position
complement(3694933..3695691)
Genome map
AA seq 252 aa AA seqDB search
MLTKRIIPCLDVKEGRVVKGVQFVELRDAGDPVELAAFYDEEGADELVFLDISASHEGRE
TMVDVVEQVAAKLAIPFTVGGGINSIDDMKRLLRAGADKVSLNTAALLNPYLIQAGADYF
GSQCIVVAIDAKYDESLGSWRVYTHGGRRETDWEVVKWAQESVKLGAGEILLTSMDSDGE
KKGFNLALTKAVSSAVSVPVIASGGAGEASHFLSAFEEGAADAALAASIFHYKETSVKEV
KSYLKEKGVQVR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgaaacggattatcccttgtctggatgtaaaagaaggacgggtggtaaaggga
gttcagtttgtcgagctccgagatgcgggtgatccggttgagcttgctgccttttatgat
gaagaaggtgcagatgaactggtgttccttgatatttctgcctcccatgaagggcgtgaa
acgatggtggatgtggtcgagcaggtggctgcaaaattggcgattccgttcacagtcggg
ggcggcatcaactctattgatgacatgaagcggttgttgcgtgcaggtgcggataaggtt
tctctaaacacggctgccttgttgaatccttatttgatccaagccggagcggattacttt
ggctcgcaatgcattgttgtagcgattgacgctaagtatgacgagagcctcggttcgtgg
agagtgtatacgcatggcgggcgcagggaaacggactgggaagtggtgaaatgggcacaa
gaatcggttaagttaggcgcaggggagattttattaactagcatggacagtgacggggag
aaaaaaggctttaacctagctttgaccaaagcggtaagttcggctgtttctgtaccggta
attgcctctggtggggcaggtgaagcgtctcattttctttcggcgtttgaagaaggagca
gcagatgcagcacttgcagcttctattttccactataaagaaacgagtgttaaagaagta
aaaagctatcttaaggagaaaggggtgcaggttcgatga

DBGET integrated database retrieval system