KEGG   Bacteroides helcogenes: Bache_1042Help
Entry
Bache_1042        CDS       T01393                                 

Definition
(GenBank) translation elongation factor 1A (EF-1A/EF-Tu)
  KO
K02358  elongation factor Tu
Organism
bhl  Bacteroides helcogenes
Brite
Translation factors [BR:bhl03012]
 Eukaryotic Type
  Elongation factors
   Bache_1042
 Prokaryotic Type
   Bache_1042
Mitochondrial biogenesis [BR:bhl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Bache_1042
Exosome [BR:bhl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Bache_1042
  Exosomal proteins of breast cancer cells
   Bache_1042
  Exosomal proteins of colorectal cancer cells
   Bache_1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW
Motif
Other DBs
NCBI-ProteinID: ADV43052
UniProt: E6SRA8
LinkDB All DBs
Position
1339556..1340740
Genome map
AA seq 394 aa AA seqDB search
MAKEKFERTKPHVNIGTIGHVDHGKTTLTAAITTVLAKKGLSELRSFDSIDNAPEEKERG
ITINTSHVEYETANRHYAHVDCPGHADYVKNMVTGAAQMDGAIIVVAATDGPMPQTREHI
LLARQVNVPRLVVFMNKCDMVDDPEMLELVEMEMRELLSAYEFDGDNTPFIQGSALGALN
GVEKWENKVMELMDAVDTWIPLPPRDVDKPFLMPVEDVFSITGRGTVATGRIEAGVIHVG
DEVEILGLGEDKKSVVTGVEMFRKLLDQGEAGDNVGLLLRGIDKNEIKRGMVLCKPGQIK
PHSKFKASIYVLKKEEGGRHTPFHNKYRPQFYLRTMDCTGEITLPEGTEMVMPGDNVAIN
VELIYPVALNVGLRFAIREGGRTVGSGQITEILD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaaattcgaacgtaccaaaccgcacgtaaacattggtacaattggtcac
gttgaccacggtaaaaccacgttgacagctgctatcactacggtgttggcaaagaaaggc
ctttctgaattgcgttctttcgattctatcgataacgctcctgaagaaaaggaaagaggt
atcactatcaatacttctcacgtagagtatgaaacagctaaccgtcactatgcacacgtt
gactgtccgggtcacgccgactatgtaaagaacatggtaactggtgctgctcagatggac
ggtgctatcatcgtagttgctgctactgacggtccgatgcctcagactcgtgagcacatt
ttgctggctcgtcaggtaaacgttccgagactggttgtgtttatgaataagtgtgacatg
gttgatgatcctgaaatgttggagcttgttgagatggaaatgcgtgagttgctttcagct
tacgaattcgatggcgataacactccgtttatccagggatctgctcttggtgcattgaac
ggtgtcgaaaaatgggaaaacaaggttatggaactgatggatgcagttgatacttggatt
ccgttgcctccgcgtgatgttgacaaaccgttcttgatgccggttgaggatgtattctca
attacgggtcgtggtactgtggcaactggtcgtattgaagctggtgttatccatgtaggt
gacgaagttgaaatccttggcttgggcgaagataagaagtctgttgtgactggtgttgaa
atgttccgtaaacttttggatcaaggtgaagccggtgataacgtaggtttgttgcttcgt
ggtattgataagaatgaaatcaagcgtggtatggttctttgtaaaccgggtcagattaag
cctcactctaaattcaaagcttctatctacgttttgaagaaagaagaaggtggacgtcac
actccgttccataacaaataccgtcctcaattctatctgcgtactatggactgtacaggt
gaaattactcttccggaaggaactgaaatggtaatgcctggtgataacgtagcaatcaat
gtagaattgatctacccggtagcattgaacgtaggtttgcgtttcgctatccgtgaaggt
ggtcgtacagtaggttctggtcagattactgaaattcttgactaa

DBGET integrated database retrieval system