KEGG   Bacteroides helcogenes: Bache_1176Help
Entry
Bache_1176        CDS       T01393                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00240  Pyrimidine metabolism
bhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bache_1176
Enzymes [BR:bhl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Bache_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK FUR zf-C4pol
Motif
Other DBs
NCBI-ProteinID: ADV43186
UniProt: E6SSS3
LinkDB All DBs
Position
complement(1498563..1499183)
Genome map
AA seq 206 aa AA seqDB search
MVLFSEDHIQETKRRGRIEVICGSMFSGKTEELIRRLKRAKFARQRVEIFKPAIDTRYSD
EDVVSHDSHSIASTPIDSSASILLFTSEIDVVGIDEAQFFDNGLIEVCNQLANNGVRVIV
AGLDMDFRGIPFGPMPGLCAIADEVSKVHAICVKCGQLASFSHRTVKNDKQVLLGETAEY
EPLCRECYQRAIREDQQAASPIDRQP
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggtattattctcagaagatcatatccaggaaaccaaacgcagaggaagaattgaggtt
atttgcggatcgatgttctccggtaaaacggaagaactgatacggcgtctcaaacgcgca
aaatttgccagacaacgggtagaaatattcaaaccggccatagacacacgttactctgat
gaggatgtcgtatcacatgacagtcactccattgcatccacaccgatagactcatcagca
agtatattgcttttcacttccgaaattgatgtggtaggtattgatgaagcgcaatttttc
gacaacggtctgattgaagtatgcaatcagcttgccaataacggtgtacgtgtcattgtt
gccggactggacatggattttcgtggcataccattcggtccgatgccgggactatgtgcc
atcgcggacgaagtatctaaagtgcatgccatttgtgtaaaatgtggtcaactggcttcc
ttttctcaccgtaccgtcaagaatgacaagcaggtgctattaggagagaccgccgaatac
gagcccctgtgccgcgaatgctatcaacgggccatcagggaagatcaacaagcggcaagc
ccaatagaccgacaaccttaa

DBGET integrated database retrieval system