KEGG   Bacteroides helcogenes: Bache_1322Help
Entry
Bache_1322        CDS       T01393                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00473  D-Alanine metabolism
bhl01100  Metabolic pathways
bhl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bhl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bache_1322
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bache_1322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhl01011]
    Bache_1322
Enzymes [BR:bhl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bache_1322
Peptidoglycan biosynthesis and degradation proteins [BR:bhl01011]
 Precursor biosynthesis
  Racemase
   Bache_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ADV43328
UniProt: E6SU27
LinkDB All DBs
Position
1674710..1677205
Genome map
AA seq 831 aa AA seqDB search
MSYSIENIVEIIGAQRIGNVSATIDWLLTDSRSLSFPEETLFFALTTKRNDGARYIPDLY
ARGVRNFVVSKESMKRFDVQPFSGSQFSTANFLVVSNPLKALQKLAEQHREQFQVPVIGI
TGSNGKTIVKEWLHQLLSAERVIVRSPRSYNSQIGVPLSVWQMNEQSGLAIFEAGISEPG
EMRALQNIIKPTIGILTNIGGAHQENFFSLQEKCMEKLALFKNCDVVIYNGDDEFISNCV
AKSMLSAREIAWSRKDMERPLYIGKVEKKDDCTVISYRYLDMDNTFTLPFIDDASVENSL
NCLAACLYLMLPAEKITERMGRLEPVAMRLEVKEGKNGCVLINDSYNSDLGSLDIALNFL
YRRSLSNGLKRTLILSDILETGQNTSTLYRQVAQLVNSRKIERIIGVGSEISTCAARFNI
ENAFYPNTDALMNAVVKGKLRLENEIILIKGARKFGFDALTEVLEKKVHETILEVNLGAM
IANLNYYRGKLKPETKIVCMVKASAYGAGSYEIAKTLQEHRVDYLAVAVADEGSELRKAG
ITASIIIMNPEMTAFKTMFDYKLEPEVYSFGLLEALIKEAEKEGITNFPVHVKLDTGMHR
LGFAPEDMPRLIERLKGQNAVIPRSVFSHFVGSDSPQFDAFTRRQIVMFEKASVELQEAF
AHKILRHICNSAGIERFPGAQFDMVRLGLGLYGISPIDNSILNNVSTLKTTILQIRDVPA
EDTVGYSRKGHLNRPSRIAAIPIGYADGLNRHLGNGHAYCLVNGCKASYVGNICMDVCMI
DVTDIDCKEGDTVEIFGDHLPITVLSDVLDTIPYEVLTSVSTRVKRIYYQD
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtactcgattgaaaatatagttgaaattattggtgcacagcgcataggaaatgtg
tctgccactattgactggctgcttactgacagccgttccttgagctttcccgaagagact
ctgttttttgccttgactaccaagcgcaatgacggtgcacgttatattcctgacctgtat
gcccgcggggtgcgcaattttgttgtcagtaaagaaagcatgaagcgctttgatgtgcag
cctttttctggcagtcaattttctacggccaattttttagtggtatccaatcctttgaaa
gccttgcagaaacttgccgaacagcatcgggaacagtttcaggttcctgtaatcggtatc
acaggcagtaatggcaagacgattgttaaagaatggctgcatcaactgcttagtgccgaa
cgagtgatcgtacgctctccccgcagttacaactctcagatcggtgttcctctgtctgtt
tggcaaatgaatgagcaatccggacttgccatttttgaggccggcatttcggaaccggga
gagatgcgcgctttgcaaaatatcattaagcccactatcggtatcttgactaatataggc
ggtgcgcatcaggaaaactttttttcattgcaagagaaatgcatggagaaactcgcgctt
ttcaaaaactgtgatgtggtgatttataatggagatgatgaatttatcagcaattgtgtg
gcaaaatccatgctttctgcccgtgaaatagcgtggagcaggaaagatatggaacgtcct
ttgtatataggtaaggtagaaaagaaggatgattgcacggtgatttcctatcgctatctg
gatatggataatacatttactttgcctttcattgacgatgcttctgtagagaactcgctg
aattgccttgccgcttgcctttaccttatgctgcctgctgagaagataacggaacgcatg
ggcagattggagccggttgccatgcgtctggaagtgaaagaaggaaagaatggttgtgta
ttgataaacgatagttataattcggaccttggctcgctggatatcgccctgaattttctt
tatcgacgttcgctttccaatggtttgaagcgcactctgatcctttccgatatactggaa
acggggcagaatacgtccactctttatcggcaagtggcacaattggtgaacagccgtaag
attgagcgtattatcggcgtggggagtgaaatttctacttgtgctgcccgtttcaacata
gagaatgctttttacccgaatacggatgcgctgatgaatgctgtcgtaaaaggaaaactg
cgattggagaatgaaatcattctgattaaaggtgcacgcaagttcggttttgatgctttg
acggaagtattggaaaagaaagtgcatgagacgatactggaagtcaatcttggcgcaatg
attgcaaaccttaattattatcggggcaagctgaaaccggaaactaagattgtatgtatg
gtgaaggcttcggcctatggcgcaggctcttatgagattgcaaagactttgcaggaacat
cgcgtggactatctggcggtagcagtggctgatgaggggtctgaactacgtaaggcgggg
attacggcaagcatcatcatcatgaatcctgaaatgacggcattcaagacgatgttcgat
tacaaactggaacctgaagtttatagctttggcctgttggaagccttgattaaggaggct
gaaaaagagggtatcacaaactttccggttcatgtgaaactggatacgggaatgcaccgc
ttgggatttgctcccgaagacatgccccgtctgattgaacgtttgaagggacagaatgcc
gtgataccccgttctgtcttctcgcactttgtgggcagtgactctcctcagttcgacgct
tttacacgccggcaaatagtaatgtttgaaaaggcatccgtggaattgcaggaagcattc
gcacataagatacttcgccatatttgcaactccgcaggtatcgaacgttttccgggggca
cagttcgatatggtgcgtttgggattgggattatatggcatcagccctattgataattcc
atattgaacaatgtaagtacgctgaaaacaaccattcttcagatacgtgacgttccggcg
gaagataccgtggggtacagcaggaagggacatttgaatcgtccgtcgcgtattgccgcc
attcctatcggctatgccgatgggctgaaccggcatcttggaaacggacatgcctactgt
ctggtaaatggctgcaaggcttcttatgtgggtaacatctgcatggatgtctgcatgatc
gatgtgacggatattgattgcaaagaaggggatacggtagaaatattcggtgatcatctg
cctattacagtgctttccgatgttcttgatacaataccttatgaggtcttgacaagtgtt
tcgacacgtgtcaaacggatttattatcaggactaa

DBGET integrated database retrieval system