KEGG   Bacteroides helcogenes: Bache_1672Help
Entry
Bache_1672        CDS       T01393                                 

Definition
(GenBank) Glycoside hydrolase 97
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00500  Starch and sucrose metabolism
bhl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Bache_1672
Enzymes [BR:bhl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Bache_1672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: ADV43672
UniProt: E6SN03
LinkDB All DBs
Position
2107123..2109309
Genome map
AA seq 728 aa AA seqDB search
MRDMRTNCTKVIFLLFALLAGGMVKAEDIKQSTAENIGSPNGNLQLNFTVNAQGQPVYEL
FYKGKAVIKPSRLGLELKNDPGLMNGFTLVDAKTSAFDETWQPVWGEVKQIRNHYNELVV
TLNQKEQDRNIIIRFRLFDDGIGFRYEFPLQKNLNYFVIKEEHTQFAMTGDHKAFWIPGD
YDTQEYDYTESRLSEIRGLMKEAVTENSSQTQFSPTGVQTSLQMKTADGLYINLHEAALV
DYSCMHLNLDDKNLVFESWLTPDVQGDKGYLQAPCKSPWRTVIVSDDARDILASKITLNL
NEPCAYEDVSWIKPVKYVGVWWEMIAGKSTWAYTDELPSVKLGETDYSKVKPNGRHGANN
ENVKRYIDFAAANGLDQVLVEGWNEGWEDWFGNSKDYVFDFVTPYPDFNVKMLNDYAKSK
GVKLMMHHETSASVRNYERHMDKAYQFMVDNGYNAVKSGYVGNIIPRGEHHYGQWMNNHY
LYAVKKAADYRICVNGHEAVRPTGLCRTYPNLIGNESARGTEYEAFGGSKPFHTTLLPFN
RLIGGPMDYTPGIFDIKLDFMGDLPHGRVQTTLAKQLALYVTLYSPLQMAADLVENYEKH
MDAFQFIKDVAVDWDDSKYIEAEPGDYITVARKAKGTGNWFVGGITDENARTANFTLDFL
ESGKQYVATLYADGKDADYKENPTSYRIKKGIVTNKTKMSVKEARSGGFALSLIEAVPAD
RKVVGKWK
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgagagacatgagaacgaattgtaccaaagtgatttttttgctgtttgctttgttggcg
ggcggcatggtgaaagctgaagacatcaaacagtcaacggcagaaaacattggctccccg
aacggtaatctgcaattgaattttactgtaaacgctcagggacagcctgtttacgaactt
ttttataagggaaaggctgtgattaaaccctccaggcttggactggaattgaagaatgat
ccgggattgatgaatggctttacattagttgatgccaaaacttctgcgtttgatgaaaca
tggcaaccggtttggggtgaagtgaagcaaatccgaaaccattacaatgaactggtcgtg
acgttgaaccaaaaggagcaagaccgcaatatcattatccgtttcaggcttttcgatgat
ggtattggtttccgttacgagtttcccttgcagaagaatctgaattattttgttatcaaa
gaggagcatacacagtttgccatgaccggtgatcataaagcattctggattccaggtgac
tatgatacgcaggagtatgattatacggagtccagactctctgaaatacgtggactgatg
aaagaggctgttacggaaaactcatcgcagactcaattctcgccaacaggtgtgcagact
tccttacagatgaagacggccgatggtctatacatcaatctgcatgaagcggctctggtg
gattattcttgcatgcacctgaatctggatgacaaaaacttagtctttgaatcttggctg
actcccgatgtgcagggtgacaaaggctatcttcaggctccttgtaagtcaccgtggcgt
acagttatcgtgagcgatgacgcacgcgatattttggcttcaaagataacgttgaatctg
aatgagccttgtgcctatgaggatgtatcatggataaagcccgtgaagtatgtaggtgta
tggtgggaaatgatcgcagggaagagtacttgggcctatacggatgaattgccttcggtg
aagttgggcgagactgattattcaaaagtgaaaccgaacggacgtcacggcgccaacaac
gagaatgtcaaacgttatattgactttgccgctgccaacggtcttgatcaggtattggtg
gaaggctggaatgaaggatgggaagattggttcggtaactcaaaggattatgtgtttgac
ttcgtgactccatatcctgattttaatgtgaagatgctgaatgattatgccaaaagcaag
ggtgtgaagttgatgatgcatcatgaaacttctgcttctgtaagaaactacgaacgccat
atggacaaggcttatcagtttatggtggataatggctacaatgcggtgaaaagcggatat
gtaggaaatatcatcccccgtggcgagcatcattatggacagtggatgaataatcattac
ctctatgccgtgaagaaagctgctgattaccggatttgcgtcaatgggcatgaagccgtg
cgccccaccggtttgtgccgtacttatccgaacctgatcggcaatgaatctgcacgtggc
acggaatatgaggcattcggcggcagcaaaccgttccataccaccttgcttcctttcaac
cgtcttatcggcggaccgatggattatactccgggtatttttgatatcaaacttgacttt
atgggtgacctgcctcacggacgtgtgcagactacgctggcaaagcagttggctctgtat
gttactctgtacagcccattgcagatggctgccgatttggtggaaaattatgagaaacac
atggatgctttccagttcatcaaggatgttgctgttgactgggatgacagcaaatacatc
gaagccgagcccggggattatattacagtggctcgtaaagcaaagggaactggaaattgg
tttgtcggaggaatcactgatgaaaatgcacgtaccgccaactttactcttgatttcctt
gaatccggcaagcaatatgttgctaccctttatgccgatggaaaagatgcggactataag
gagaatcctacttcttaccggataaagaaaggaattgtgaccaataagacgaagatgtcc
gtgaaagaggcacgcagtggcggttttgcgttgagtctgatagaagctgttccggcagac
aggaaggttgtgggaaaatggaaataa

DBGET integrated database retrieval system