KEGG   Bordetella holmesii 44057: D558_1276Help
Entry
D558_1276         CDS       T03379                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase family protein
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
bhm  Bordetella holmesii 44057
Pathway
bhm00550  Peptidoglycan biosynthesis
bhm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D558_1276
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bhm01002]
    D558_1276
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhm01011]
    D558_1276
Enzymes [BR:bhm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D558_1276
Peptidases and inhibitors [BR:bhm01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   D558_1276
Peptidoglycan biosynthesis and degradation proteins [BR:bhm01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   D558_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13 Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: AIT25954
LinkDB All DBs
Position
complement(1212414..1213607)
Genome map
AA seq 397 aa AA seqDB search
MLAGSMPVMAQQQTPAAVSPAASMSAPATAAVADSVVAVGDLASVPAPTVAARAWITVDV
NSGQVLAASNPDQKVEPASLTKIMTAYVVFNALDEKRLTLERQVPVSEHAWRTGGSRMFI
EPRKPVTADELIQGMIVQSGNDASVALAEAVGGSETAFAALMNEQAERLGMKGTHFMNAT
GLPDPQHITTVRDLATLATHLVADHPEYFHYYKQKSYTYNKITQPNRNRLLWADPSVDGM
KTGHTDSAGFCLVSTALRGDRRVLTVLVGADSESTRAEESLKLLNWSFQNFDTVKLYDKS
QPGLDARVWEGKAENVKLGPPNPIWLAVPRGKGSEIKPVAQRTDPLVAPLVKGQQVGMLQ
LTLDGKVLRSEPLVVQEDVERAGFFGRMTDTVKRWFQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttggccggctcgatgcctgtcatggcgcagcaacagacgccggcggccgtctcgcct
gcggcctccatgtccgcgccggccacggcagcggtggcagattccgtggtcgccgtcggc
gacttggcttcggtgcccgcaccgacggttgcggcgcgcgcctggatcacggtcgatgtc
aacagcggccaagtgcttgctgcttccaaccccgatcagaaagtcgagcctgcctcgctg
accaagatcatgacggcgtatgtcgtgttcaacgccctcgacgaaaaacgtctgacgctg
gagcggcaggtgccggtgtccgagcacgcctggcgcacgggtggctcgcgcatgttcatc
gagccgcgcaagccggtcaccgccgacgagctcatccagggcatgatcgtgcagtcgggc
aatgacgcgtccgtggcgctggccgaagccgtgggtggcagcgagacggcatttgccgct
ctcatgaacgaacaggccgagcgcctgggaatgaagggcacgcacttcatgaatgcgacc
gggctgccggatccgcagcacatcaccacggtgcgggatctggccacgctggcgacccat
ctggtggccgatcatcccgagtacttccactactacaagcaaaagagctacacctacaac
aagatcactcagcccaatcgcaatcgtctgctttgggccgatccctcggtggacggcatg
aaaaccggccataccgattcagcgggtttttgcctggtgtcgaccgccctgcgcggcgat
cgccgtgtgctgaccgtgctggtgggtgccgacagtgagtccacccgggccgaagaaagc
ctcaaactgctgaactggagcttccagaacttcgatacggtcaaactctacgacaagagc
cagcctggtctggatgcgcgtgtctgggagggcaaggccgagaacgtcaagctcgggccg
cccaaccccatctggctggccgtgccgcgtggcaagggcagtgagatcaagcccgttgcc
cagcggaccgatccgctggtcgcgcccttggtcaagggccagcaagtcggcatgctgcaa
ttgaccctcgatggcaaggttctgcgttccgagccgttggtcgttcaagaggatgtcgag
cgcgccggtttcttcggccgcatgaccgataccgtcaagcgctggttccagtaa

DBGET integrated database retrieval system