KEGG   Bordetella holmesii 44057: D558_2926Help
Entry
D558_2926         CDS       T03379                                 

Gene name
sodC
Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bhm  Bordetella holmesii 44057
Brite
Enzymes [BR:bhm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     D558_2926 (sodC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AIT27579
LinkDB All DBs
Position
2751108..2751596
Genome map
AA seq 162 aa AA seqDB search
MLAAAGSVAAQTVDMYAAGPKGPEQKVGTIKIEQTKYGALLTPVLEGLPPGVHGFHLHDK
ASCDATTADGKPVAAGAAGGHWDPDKSNSHKGPYDDSGHKGDLPAIYVMPDGKANYPVLA
PRLKASEFKGHALMIHAGGDNHSDHPMPLGGGGARIICGVVK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
ttgctggctgcagcaggcagcgtggcggcgcagaccgtcgatatgtatgccgccgggccc
aaagggccggaacaaaaagtgggcaccatcaagatcgagcagactaaatacggcgccttg
ctgacgccggttctggaagggctgccgccaggggtgcacggctttcacctgcacgacaag
gcgtcgtgcgacgccaccaccgctgacggcaaacccgttgcggcgggtgctgcgggaggg
cattgggatccggataagagcaattcgcacaaaggcccctacgacgacagcggccataag
ggcgacctgcctgccatctacgtgatgcctgacggcaaagccaactatcccgtattggcg
ccacgcttgaaggccagcgagttcaagggccatgcgctcatgatccacgccggtggcgac
aaccacagcgatcaccccatgccgttgggcggtgggggcgcgcgcatcatctgcggcgtc
gtcaagtaa

DBGET integrated database retrieval system