KEGG   Bartonella henselae BM1374163: PRJBM_00129Help
Entry
PRJBM_00129       CDS       T03068                                 

Gene name
fabI1
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bhn  Bartonella henselae BM1374163
Pathway
bhn00061  Fatty acid biosynthesis
bhn00780  Biotin metabolism
bhn01100  Metabolic pathways
bhn01130  Biosynthesis of antibiotics
bhn01212  Fatty acid metabolism
Module
bhn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bhn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PRJBM_00129 (fabI1)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PRJBM_00129 (fabI1)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    PRJBM_00129 (fabI1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bhn01004]
    PRJBM_00129 (fabI1)
Enzymes [BR:bhn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     PRJBM_00129 (fabI1)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     PRJBM_00129 (fabI1)
Lipid biosynthesis proteins [BR:bhn01004]
 Fatty acid synthase
  Component type
   PRJBM_00129 (fabI1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CDO39527
LinkDB All DBs
Position
complement(169602..170420)
Genome map
AA seq 272 aa AA seqDB search
MKGLMEGKRGLIMGVANDHSIAWGIACQLAKAGAELAFTYQGEAFGKRVQPLAEKIGCKL
VLECDVEKIENVDRVFKRLEKEWKTIDFVVHAIGFSDKTQLKGRYVDVTTRENFKRTMVI
SAYSFTEIAQRAGKLMPNGGTLLTLTYGASQQVVPNYNIMGVAKAALEAMVRYLAADFGP
QNIRVNAISAGPIRTLAGNGIAAARAIFSYQRRNAPLRRNVNINEIGKSALYLLSDLSSG
VTGEIHYVDSGYNIMSMPTLEELKQSEEAQEE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtttgatggagggcaaacgtggccttattatgggggttgcaaatgaccattca
attgcttggggcattgcatgtcaacttgcaaaagcaggagctgaattagcatttacctat
caaggagaggcttttggaaaacgtgttcaaccattagcagaaaaaatcggctgcaaatta
gtacttgagtgtgacgttgaaaaaattgaaaatgttgaccgcgtctttaaacgtcttgaa
aaagaatggaaaactatagactttgttgttcatgctattggtttttcagacaagacccaa
ctaaaaggacgttatgttgatgtgacaacacgtgaaaactttaagcgtacaatggttatt
tcagcttattcctttactgaaattgctcagcgtgcgggtaaacttatgcctaatggaggt
acacttttaacactcacttatggcgcttcacagcaagttgtccctaattataatatcatg
ggtgttgctaaagctgctttagaagctatggtgcgctatttagcggccgactttggtcct
caaaatatccgtgttaatgcaatttcagccggtcctattaggacattagctggcaatggc
attgcagctgcacgagcaattttttcgtatcaacgtcgaaatgcacccctacgccgtaat
gtaaacattaatgaaatcggaaaatctgctctttacctgctttctgatttatcttcaggg
gttactggtgaaattcattatgttgattcaggttataacatcatgtctatgccaaccctt
gaagaattaaaacaaagtgaagaagctcaagaagagtaa

DBGET integrated database retrieval system