KEGG   Bartonella henselae BM1374163: PRJBM_00131Help
Entry
PRJBM_00131       CDS       T03068                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
bhn  Bartonella henselae BM1374163
Pathway
bhn00061  Fatty acid biosynthesis
bhn01100  Metabolic pathways
bhn01212  Fatty acid metabolism
Module
bhn_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bhn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PRJBM_00131 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bhn01004]
    PRJBM_00131 (fabA)
Enzymes [BR:bhn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PRJBM_00131 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PRJBM_00131 (fabA)
Lipid biosynthesis proteins [BR:bhn01004]
 Fatty acid synthase
  Component type
   PRJBM_00131 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: CDO39529
UniProt: X5M306
LinkDB All DBs
Position
complement(171747..172256)
Genome map
AA seq 169 aa AA seqDB search
MAEQKSRYTYEELLSCARGEMFGKGNAQLPAPPMLMIHRITEINETGGEYNKGMLRAEFD
ITPDLWFFNCHFIGDPVMPGCLGLDGMWQLTGFFLGWLGEPGKGRAISTGEVKLSGMVTP
QTQLLEYGIDFKRIRRGNLVLGIADGWVKADGESIYKASDLRVALFKED
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaaaagtctcgctacacttatgaagagcttctaagctgcgctcgcggcgaa
atgtttggtaagggtaatgcacaattaccagcaccaccaatgttgatgatccatcgaatc
actgaaatcaatgaaactggcggtgaatacaataaagggatgcttcgcgccgaatttgac
attactccagacctatggttctttaattgtcactttataggcgatcccgtcatgccaggg
tgtcttggtctggatggcatgtggcaattaacaggtttttttctcggttggttaggcgaa
ccaggaaaagggagggctatatcaacaggcgaagtgaaattatcaggtatggtaacacca
caaacccaacttcttgaatatggaatagattttaagcgtattcgacgtggaaatttggtc
ttgggaatagccgatggatgggtgaaagcagatggagaaagcatttataaagcgagtgat
ttacgcgttgctctcttcaaagaagactaa

DBGET integrated database retrieval system