KEGG   Bartonella henselae BM1374163: PRJBM_00614Help
Entry
PRJBM_00614       CDS       T03068                                 

Gene name
tuf1_1
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bhn  Bartonella henselae BM1374163
Brite
KEGG Orthology (KO) [BR:bhn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bhn03012]
    PRJBM_00614 (tuf1_1)
   03029 Mitochondrial biogenesis [BR:bhn03029]
    PRJBM_00614 (tuf1_1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bhn04147]
    PRJBM_00614 (tuf1_1)
Translation factors [BR:bhn03012]
 Eukaryotic Type
  Elongation factors
   PRJBM_00614 (tuf1_1)
 Prokaryotic Type
   PRJBM_00614 (tuf1_1)
Mitochondrial biogenesis [BR:bhn03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PRJBM_00614 (tuf1_1)
Exosome [BR:bhn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PRJBM_00614 (tuf1_1)
  Exosomal proteins of breast cancer cells
   PRJBM_00614 (tuf1_1)
  Exosomal proteins of colorectal cancer cells
   PRJBM_00614 (tuf1_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CDO40001
UniProt: X5M563
LinkDB All DBs
Position
703257..704432
Genome map
AA seq 391 aa AA seqDB search
MAKSKFERTKPHVNIGTIGHVDHGKTSLTAAITKYFGEFKAYDQIDAAPEERARGITIST
AHVEYETEKRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHILLARQ
VGVPAIVVFLNKVDQVDDAELLELVELEVRELLSKYDFPGDDIPIVKGSALAALEDKDKS
IGEDAVRLLMSEVDNYIPTPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGVIKVGEEV
EIIGIRPTSKTTVTGVEMFRKLLDQGQAGDNIGALLRGIDREGIERGQVLAKPASVTPHT
RFKAEAYILTKDEGGRHTPFFTNYRPQFYFRTTDVTGIVTLPEGTEMVMPGDNVAMDVSL
IVPIAMEEKLRFAIREGGRTVGAGIVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagcaaatttgaacgcacgaaaccgcatgttaatattggtacgattggtcac
gttgaccatgggaagacctcgttgacggcagcgattacgaaatattttggtgaatttaag
gcctatgaccaaattgatgcagcgcctgaggagcgtgcacgtggaattactatttctaca
gcgcatgttgaatatgaaacagagaagcggcattatgcacatgttgattgtccaggtcac
gcggattatgtgaagaacatgatcacgggcgcggcgcaaatggatggtgcgattttggtt
gtttcagctgctgatggtccgatgcctcaaacacgtgagcatattcttcttgcccgtcag
gttggtgttccagcgattgttgtttttcttaataaggttgatcaggttgatgatgctgag
cttttggagcttgttgagcttgaagttcgggagttattgtcgaaatatgattttccagga
gacgatattccgatcgttaaaggttctgctttggcagcgcttgaagataaagataaaagc
attggtgaagatgcggttcgtcttttgatgagtgaagttgataattatataccgacgcct
gaacgtcctgttgatcagccgtttttgatgccaattgaagatgttttttcgatttcgggt
cgtggaactgttgtgacgggtcgtgttgagcgtggtgttattaaggttggtgaagaagtt
gagattatcggcattcgtccaacttctaagacaacagttacaggggttgaaatgttccgc
aagcttttagatcaggggcaagcgggtgataatattggagcgctgcttcgtggtattgat
cgtgaagggattgagcgtggacaagttttggcgaagcctgcttcggttacacctcatacg
agatttaaagcagaggcttacattttgacgaaagatgaaggtggtcgtcatactccattt
ttcacgaattatcgtcctcagttttatttccgtactacggatgtaacgggaattgttacg
cttccagaaggtacagagatggttatgcctggtgataatgttgctatggatgtctctctg
attgttccaattgccatggaagaaaaacttcgttttgctatccgtgaaggtggtcgtact
gttggtgcaggtatcgtttctaagatcattgagtaa

DBGET integrated database retrieval system