KEGG   Bordetella holmesii ATCC 51541: D560_2082Help
Entry
D560_2082         CDS       T03052                                 

Definition
(GenBank) short chain dehydrogenase family protein
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00061  Fatty acid biosynthesis
bho00780  Biotin metabolism
bho01100  Metabolic pathways
bho01130  Biosynthesis of antibiotics
bho01212  Fatty acid metabolism
Module
bho_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D560_2082
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D560_2082
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    D560_2082
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bho01004]
    D560_2082
Enzymes [BR:bho01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     D560_2082
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     D560_2082
Lipid biosynthesis proteins [BR:bho01004]
 Fatty acid synthase
  Component type
   D560_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AHV92993
LinkDB All DBs
Position
complement(1947656..1948084)
Genome map
AA seq 142 aa AA seqDB search
MGFLAGKRILVTGVLSNRSIAYGIARACHQQGAKLAFTYVGDRFKERVTEFAAEFGSDVV
LPCDVAEDSQIEATFAGLKERWGGLDGLVHSIGFAPREAIAGTSSRGYRAKHSASPTTSR
PTAFRPWPRQRCRSWKAARHRS
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggctttctcgctggcaagcgcatcctcgtcactggagtgctctcgaaccgctccatc
gcctacggcatcgctcgcgcctgccatcaacaaggcgccaaactggctttcacctatgtc
ggcgaccgcttcaaggagcgtgtcactgaatttgctgccgaattcggcagcgacgtcgtg
ctgccctgcgatgtggcggaagacagccagatcgaggcgacgttcgccgggctcaaagaa
cgctggggcggcctggacgggctggtccactccatcggcttcgcgccgcgcgaagccatc
gccgggacttcctcgaggggctatcgcgcgaagcattccgcgtcgcccacgacatctcgg
cctacagctttccggccatggccaaggcagcgctgccgctcatggaaggccgcaaggcat
cggtcctga

DBGET integrated database retrieval system