KEGG   Bordetella holmesii ATCC 51541: D560_2166Help
Entry
D560_2166         CDS       T03052                                 

Definition
(GenBank) penicillin binding transpeptidase domain protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00550  Peptidoglycan biosynthesis
bho01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    D560_2166
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D560_2166
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bho01011]
    D560_2166
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bho03036]
    D560_2166
Enzymes [BR:bho01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     D560_2166
Peptidoglycan biosynthesis and degradation proteins [BR:bho01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   D560_2166
Chromosome and associated proteins [BR:bho03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    D560_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AHV92447
LinkDB All DBs
Position
2021840..2023774
Genome map
AA seq 644 aa AA seqDB search
MKRVPFFDNPVLRGQLPMWRARLVLIMLFAGLAVLAGRALFLQGLTNEFLQQQGERRYER
TLTLSATRGKILDRNNVVLASSVPARAIWAIPEDAKVATPEQINTLGKLLEIPAAELRRR
LTDDDRNFVYIKRQVPMDVADKVKQMGLPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQG
QEGVELTFNQQLSGRPGSRRVIKDRLGRVIEDVQAVTLPVDGRDLRLSIDTRLQYLVYKE
LQNALDKHQARAATAVVLDVHTGEVLALANLPSYDPNRRENWKVTTLRNQAITDTFEPGS
IMKPFTAALALDLGRISTSTMFDTGNGRFQYQGSTISDVSRNGMLDVAGVLRRSSNIGMT
MISEKLQAREMWDRFTELGLGQAPQLGFPGAAPGRLRPWDRWRLIEKATMAYGYGLSVSL
LQVARAYTTFARDGDMVSLTLVKRDSDPTSVKIYSPKTTALIRSMLEAAAGPDGAKAAQV
QGYRVAGKSGTARKIVDGKYSTHRYRSSFVGFAPVSNPKVVVAVSIDEPQVGGYYGGAIA
APVFSSIVGGTLRLMGVQPDAPFESTIVAGSRAGARDESRTHRRRERSAGLAGPARPSGG
AGRPAPGLARGASRRRVPRVPRRAWRWPPLYRAGAGCGRGGSGL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgtgttcctttcttcgacaaccccgtgttgcgcggccagttaccgatgtggcgt
gcgcgcctggtgctgatcatgctgttcgcggggctggccgtgctggccggccgagcgttg
tttctgcaaggcttgaccaacgaatttctgcagcagcagggcgagcggcgctatgagcgc
acgctgacgctgtcggccacacgtggcaagattctggatcgtaacaatgtggtgctggcc
tccagcgtcccggcacgcgccatctgggccattccggaggacgccaaggtcgccacccca
gagcagatcaatacgctgggcaagctgctggagattccggcagcggagttgcgccgccgg
ctgaccgacgatgaccgaaatttcgtctacatcaagcgccaggtgcccatggatgtggcc
gacaaggtcaagcagatgggcttgcctggcattcatcagcagcccgagtctcgccgctat
taccctgaaggcgaagtgacagcccacatcgtgggctttaataacgtagaggatcagggg
caggaaggcgttgagctgaccttcaaccagcagctctccggccggccgggctcacggcgc
gtgatcaaggatcgcctcgggcgcgtcatcgaggatgtgcaggccgtcacactgccagtc
gacggccgtgatctgcggctgtccatcgacacccgtctgcagtacctggtctacaaagag
ctgcagaacgccctggataagcaccaggcacgcgctgccacggccgtcgtgctggacgtg
cacaccggtgaggtgcttgccctggccaatctgccgtcgtatgacccgaatcgccgcgag
aactggaaagtcaccacgctgcgcaatcaggccattaccgataccttcgagccgggctcc
atcatgaagcccttcactgcagccctggcgttggatctggggcgcatcagcacctcgacc
atgttcgatacgggcaacgggcggtttcagtaccagggctccaccatcagcgatgtcagc
cgcaatggcatgctggacgtggctggggtgctgcgccgctccagcaatatcggcatgacc
atgatttccgagaagctgcaggcccgtgaaatgtgggatcgtttcacggagttgggcctt
ggacaggcaccgcaattgggcttcccgggtgcggcccccggccgtttgcggccatgggac
cgctggcgcctgatcgagaaagccacgatggcttacggttatggcctgtcggtgtcgctg
ctgcaagtcgcgcgggcctatacgaccttcgcccgcgatggcgacatggtgtcgctgacc
ttggtcaagcgcgatagcgacccgaccagcgtaaaaatctattcgcctaaaacgaccgcc
ttgatccgctccatgctcgaggccgctgccggcccggatggtgcgaaagccgcacaggtg
cagggctatcgcgtggccggcaagagcggcaccgcacgcaaaattgtcgacggcaagtac
agcacccaccgttatcgcagctccttcgtgggttttgcgccagtctccaatcccaaggtc
gtggtggcagtgtccatcgatgagccgcaggtcggcggctattacggcggtgccatcgcc
gcgccggtgttttccagcatcgtcggcggtacgctgcgcctgatgggtgtgcaacccgat
gcgccgttcgagtccaccatcgtggccgggtcgagggcgggggcgcgcgatgagtcacgt
acgcaccgtcgccgggagcgttcagccggtcttgcaggacctgcgcggccgagtgggggc
gcaggccgacctgcacctggactcgcgcgaggtgcgtccaggcgacgtgttcctcgcgtg
ccgcggcgtgcatggcgatggccgcctttatatcgagcaggcgctggctgcgggcgcggc
ggcagtggtctatga

DBGET integrated database retrieval system