KEGG   Bordetella holmesii ATCC 51541: D560_2248Help
Entry
D560_2248         CDS       T03052                                 

Definition
(GenBank) uracil-DNA glycosylase, 4 family protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bho00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    D560_2248
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bho03400]
    D560_2248
Enzymes [BR:bho01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     D560_2248
DNA repair and recombination proteins [BR:bho03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     D560_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: AHV92163
LinkDB All DBs
Position
2099196..2099894
Genome map
AA seq 232 aa AA seqDB search
MARPAPLARPEAQPLRPVVTSRPQAEEAADVSAAGNAGIDVARRVASQDLQQLEREVFAC
TACGLCQGRKHAVFGEGARPARWLVVGEAPGEQEDRRGLPFVGRSGQLLDAMLASVGMSR
ERDVFIANVIKCRPPGNRNPKPEEIAACSPYLMRQIDLIEPDRILVLGRFAAQTLLGTDA
TIGNLRGRRHTLKTEQGRDIPVVVSYHPAYLLRSPSEKARAWQDLQLALRDD
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggcccgcgcccttagcccgtcccgaggcgcagccgctgcgaccggtcgtgacc
tcccggccgcaggccgaggaggccgccgacgtatccgcggctggcaacgccggtatcgac
gttgcgcggcgcgtggccagtcaggatttgcagcaactggagcgggaagtgttcgcctgc
accgcttgcggactatgccaggggcgcaaacatgcggtctttggcgagggcgcaaggccg
gcccgctggcttgtggtgggcgaggcgccaggagagcaggaggacaggcgtggcctgcct
ttcgtggggcgttcggggcagttgctcgacgcgatgctggcgtcggtgggtatgagccgc
gagcgcgatgtattcatcgccaatgtgatcaagtgccgcccgccgggcaaccgaaatcca
aaaccggaagaaattgcagcttgcagtccttacctaatgcgtcagatcgacctgatcgag
ccggaccgcattctggtgctggggcgatttgccgcccagaccctgctgggcacggacgcg
accatcggtaatctgcggggccgccggcatacgctgaaaaccgaacagggccgggacatc
cccgtggtggtgagctatcacccggcatatttgctgcgcagcccgtccgagaaggcccgg
gcctggcaggatctgcaactggcgctgcgcgacgactga

DBGET integrated database retrieval system