KEGG   Bordetella holmesii ATCC 51541: D560_3489Help
Entry
D560_3489         CDS       T03052                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00061  Fatty acid biosynthesis
bho00780  Biotin metabolism
bho01100  Metabolic pathways
bho01212  Fatty acid metabolism
Module
bho_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D560_3489 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D560_3489 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bho01004]
    D560_3489 (fabZ)
Enzymes [BR:bho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D560_3489 (fabZ)
Lipid biosynthesis proteins [BR:bho01004]
 Fatty acid synthase
  Component type
   D560_3489 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH
Motif
Other DBs
NCBI-ProteinID: AHV94042
LinkDB All DBs
Position
complement(3232521..3232976)
Genome map
AA seq 151 aa AA seqDB search
MELDIKGIMERLPHRYPMLLIDRVLEMVPGKSIVAIKNVSINEPFFNGHFPHHPVMPGVL
IVEAMAQASALFSFTDENGGLKSEAGKTAYYLVGIDGARFRRPVVAGDQLRVEVQAERLS
RTICKYQGRALVDGQLVAEAKLMCAIRSLEE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgatatcaaggggattatggagcgtctgccgcatcgctatccgatgctgctg
attgaccgggtgctcgaaatggtccctggcaagtccatcgtcgccattaagaacgtctcg
atcaatgagccgtttttcaatggccattttccccatcatccggtgatgcccggcgtcctc
atcgtcgaggcaatggcgcaggcttcggccttgttttcgtttaccgacgaaaacggtggc
ctcaaatccgaggcaggtaagacggcgtattatctggtgggtatcgacggtgcgcggttc
cgtcgtccggtggtggcgggcgaccagttgcgcgtcgaagtccaagcagagcgcctcagc
cgcaccatctgcaagtatcagggtcgtgctctggtcgacggccaactggtagccgaggcc
aaactgatgtgcgccattcgcagtctggaagagtaa

DBGET integrated database retrieval system