KEGG   Brachyspira hampsonii: BHAMNSH16_02800Help
Entry
BHAMNSH16_02800   CDS       T05655                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
bhp  Brachyspira hampsonii
Pathway
bhp00040  Pentose and glucuronate interconversions
bhp00051  Fructose and mannose metabolism
bhp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BHAMNSH16_02800
   00051 Fructose and mannose metabolism
    BHAMNSH16_02800
Enzymes [BR:bhp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     BHAMNSH16_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N ADH_N_2
Motif
Other DBs
NCBI-ProteinID: ASJ20636
UniProt: A0A1E5NQN9
LinkDB All DBs
Position
699711..700754
Genome map
AA seq 347 aa AA seqDB search
MNSKMKVAVMTDLQKIDFIERDIPKPKNDEVLVKLEYVGVCGSDLHYYEHGAIGKYIVKP
PFVLGHECSGTVVEIGDKVKHLKVGDKVALEPGKTCGECEFCRSGKYNLCPDVIFFATPP
IDGVFQEYVTHPEHLSFKLPDNLTTMEGSLIEPLSVGMHAAMQGDAKLGQTAFVTGTGCI
GLCSMLSLKACGISKVYVIDIIKKRLDKALELGASGVIDASKEDVVKRVYELTNGKGSDL
TIETSGAESVTNQAIEFAKKGSTIVLVGYSKTGMVNMNLGLALDKELTFKTVFRYRHIFP
LSIEAVSSGAINIKNIVSNIYEFSDLQNALDNSLNDKENIVKTVIKI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaattctaaaatgaaagtagctgttatgacagatttacaaaaaattgatttcatagaa
agagatataccaaaacccaagaatgatgaagttttagtaaaattagaatatgtaggagtt
tgcggttctgatttgcattactatgaacatggagctataggaaagtatattgtaaagcct
ccatttgttttgggacatgaatgcagcggtacagtggtagaaataggagataaggttaaa
catttaaaagtaggagataaagtagcattagaaccgggtaaaacatgcggagaatgcgag
ttttgccgaagcggtaaatacaatctatgtcctgatgtaatattttttgcaacacctcct
atagatggagtatttcaggaatatgtaactcaccctgaacatttatctttcaaacttcct
gataatttaactactatggaaggctctttaatagaacctttatctgtaggaatgcatgcg
gctatgcagggagatgccaaattaggacaaactgcatttgttacaggtacaggatgtata
ggtttatgctctatgctgtcattaaaagcatgcggaatatcaaaagtttatgtaatagat
ataataaaaaagcgtttagacaaagcattagaattgggggcttccggagttatagatgct
tccaaagaagatgtggttaaaagagtttatgaattaacaaatggaaaaggaagtgattta
actatagagacatcaggtgccgaatctgtaacaaatcaggctatagaatttgctaaaaaa
ggttctactatagtattagtcggatacagcaaaacaggaatggtaaatatgaatttaggt
ttggcattggataaagaattaactttcaaaacagtattcagatacagacatatattccca
ttatcaatagaagctgtatcaagcggagctattaacataaaaaatatagtaagcaatatt
tatgaatttagtgatttgcaaaatgcgttggataatagcctaaatgataaagagaatata
gtaaaaacagtaataaaaatttaa

DBGET integrated database retrieval system