KEGG   Brachyspira hampsonii: BHAMNSH16_04155Help
Entry
BHAMNSH16_04155   CDS       T05655                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bhp  Brachyspira hampsonii
Pathway
bhp00500  Starch and sucrose metabolism
bhp01100  Metabolic pathways
bhp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BHAMNSH16_04155
Enzymes [BR:bhp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BHAMNSH16_04155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: ASJ20881
UniProt: A0A1E5NRW7
LinkDB All DBs
Position
1011275..1013836
Genome map
AA seq 853 aa AA seqDB search
MKLNKYMVSPSVPKELEPLIEITKNFWWCWNQKAITLLRTIDIDNWDKRDHNPIRVLGES
LQERFDAMLQDDAAMMNLAEVYDEFKTYMNQETWYNSLDESKKTKNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPLVAMGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVEDRDITAQL
YGGNLETRIQQEILLGIGGVKALDKLGIKPTIYHMNEGHSAFLSLERIRQLMENNNLDKE
TAREVVYSSNIFTTHTPVPAGNDIFPIDMIQKYFTEYVKHINMSMDEFIRLGRINPDDQK
ESFCMTVLALNLSAENNGVSELHGHVSRNMWKDIWRGVPVNELPIDSITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEYEIWERVQKIPDAELWRTHERRKERLIDFCRDRLKTQITN
RGFTKKEIEHADQILSPEALTIGFARRFATYKRGTLLFKDLERLKKIVSNSERPVQIIFA
GKAHPHDNGGKELIRNIAEICRREDFRDHIVFIEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDGQNGWAIGNREEYTDLEYQDEVESKALYNVL
ENEIIPLFYERGRDNIPRQWVAAMKWSMQTVCPVFSTNRMVADYFNKFYNNASKRFFNMT
ENEFDKAKNLKNWKNDIISKWSKVSFENTISEMPSRNLKVGSKFEVKTIVNLGDIAPDSV
RIELYYGKLSMKENIIDPITVEMKHSSDLGNGRHSFSGTLECTNSGQSGYAIRMYPYHKD
LSYKFDMKLVIWS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataaatatatggtttcaccatcggtaccaaaagaattggagccacttata
gaaattactaaaaacttttggtggtgctggaatcagaaagcaataactttattgagaacg
atagatattgataattgggataaaagagatcataaccctataagagttttaggcgaatct
ttacaagagcgttttgatgctatgcttcaagatgatgctgctatgatgaatttagctgaa
gtttatgatgagtttaaaacttacatgaatcaggaaacttggtataatagtttagatgaa
agtaaaaaaactaaaaacgaaaaaatagcttatttttcttttgaatacggacttcatgaa
tctttgcctaactattcaggcggtcttggtatattatcaggagatcacttaaaatctgca
agtgatttaggtttgcctttggtagcaatgggactactatacagaaagggatatttcaga
caatatttaaatgctgacggctggcagcaggaatatgatatagaaaatgatttctttaac
ttagctttagaaaaagttttagataaaaacggcgaaactatgaaggtagatgttgattta
cccggaagaaaagtttatgctcagatatggaaagctaatgtaggaagaattgaactttac
tatttggatgctaatatagaagaaaacagcgttgaagatagagatattacagctcagctt
tacggcggtaacttagaaactaggatacagcaggaaatacttcttggtattggaggagtt
aaggcattagataaattaggcattaaacctacaatataccacatgaatgaaggacacagt
gcttttctttctttagagagaataagacaattaatggaaaataataatttagataaagag
acagcaagagaggtagtttacagttctaatatatttaccactcacactcctgtacctgcc
ggtaatgatatattccctatagatatgatacaaaaatactttacagaatatgttaagcat
ataaatatgtctatggatgagttcataagactaggaagaattaatcctgatgatcaaaaa
gaaagtttctgtatgacagttcttgctcttaatttatcagctgaaaataacggagtaagc
gaacttcatggacatgtatcaagaaatatgtggaaagatatatggagaggcgttcctgtt
aatgagcttcctatagattctattactaacggaattcatactttaagctggatatctttt
gatatgcagaacttacttgacagatatttaggacctcgttggagaactaaaccattagaa
tatgaaatttgggaaagagttcagaaaatacctgatgcagaactttggagaactcatgaa
agaagaaaagaaagacttattgatttctgcagagacagattaaaaactcaaattacaaac
agaggattcacaaaaaaagaaatagaacatgcagatcaaatactttctccggaagcttta
actataggttttgcaaggagatttgctacatataaaagaggaacattgcttttcaaagat
ttagaaagattaaagaaaattgtttctaattctgaaagacctgtacaaataatatttgca
ggtaaagctcacccgcatgataacggcggtaaagaattaataagaaatattgcagaaatc
tgcagaagagaagattttagagatcatatagtatttatagaagattatgatataaatgtt
gccagatatatggttcaaggcgtagatgtatggcttaataaccctagaagacctttagaa
gcaagcggtacaagcggtatgaaagttccaccaaacggaggattaaacttcagcgtatta
gacggatggtgggatgaagcttatgatggtcaaaacggttgggctataggcaacagagaa
gagtatacagatttagaatatcaagatgaagttgaaagtaaggctctttataatgtatta
gaaaatgaaattatacctctattctatgaaagaggaagagataatatacctagacaatgg
gttgctgctatgaaatggagtatgcagactgtttgtccagtattttctactaacagaatg
gttgctgactactttaataaattctacaataatgcaagtaaaagattcttcaatatgacc
gaaaatgaatttgataaagctaaaaatctaaaaaattggaagaatgatattatttcaaaa
tggtctaaagtttcatttgaaaatacaatttctgaaatgccttcaagaaacttaaaagtt
ggaagtaaatttgaagttaaaactatagttaatcttggagatatagcacctgattctgta
agaatagaactttattatggtaagctgagtatgaaagaaaatattatagatcctattaca
gttgaaatgaagcattcttcagatttaggaaacggcagacattctttctccggtacttta
gaatgtactaatagcggacaaagcggttatgctataagaatgtatccatatcataaggac
ttaagctataaatttgatatgaaacttgttatatggagttaa

DBGET integrated database retrieval system