KEGG   Borrelia hermsii DAH: BH0243Help
Entry
BH0243            CDS       T00764                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bhr  Borrelia hermsii DAH
Pathway
bhr00564  Glycerophospholipid metabolism
bhr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BH0243
Enzymes [BR:bhr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BH0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AAX16759
LinkDB All DBs
Position
250381..251943
Genome map
AA seq 520 aa AA seqDB search
MSKNGKEELKNIDNQAFDLIIVGGGATGLSIGIDSITRGYKTLLIDKFDYAKGTSSRSTK
LIHGGVRYLAQFNLSLVKEALHEKALFEKNAPHLVSKRAFITPIYNLLSIPYYYFGLSWY
HNLLGKYKKSKYKTKLLSKSKTIEKMPNIKTKGLKCSVLYYDNSFDDARMAISMLRTFTE
KGGIAFNYTELTGFTKRNGKISGAIIKDTINGEQVIINSKCIINATGIFADELRKLDDTN
ATNIIKPSQGTHLIIKKDKLRTKYAMLMPTTSDKRVLFSIPWYDGIICGSTDISIDKIEE
EPKRLESEIEFIIKNMNNYLDIKITKNDILSVYTGIRPLIIDPKKEQNTSKISRNEKIFV
SDSNLITIAGGKYTTCRKMAEKVIQKAIDAKLIPDSIPKTENLKLHGYIEREEALKIPEH
FRVYGSDFKYLSQMKDFNNKIHTDLPLTEAQITFAIEFEQAKTIEDILSRRTRSLLLNAK
ATIEATPKVAEIMMHKLGKSEKWKNEQIKSFKEVATKYLA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaatggaaaagaagaattaaaaaacattgataatcaagcttttgatttaatc
atagttggcggaggagcaactggtcttagtattggaatagattcaattacaagaggatac
aaaactttactcattgacaaatttgactatgcaaaaggcacctcctctagatcaactaag
ttaatacatggaggagtaagatatttagcccaatttaatttatctttagtaaaagaggcc
ctacatgagaaagcgttatttgaaaaaaatgcacctcacctagttagtaaacgtgcattt
attacccccatatacaacctcttaagcataccctactactattttggactaagttggtac
cataaccttcttggaaagtacaaaaagtctaaatataaaacaaagctactatcaaaatcc
aaaacaatagagaaaatgccaaatatcaaaaccaaaggccttaaatgttctgttttatac
tatgacaattcatttgatgatgctaggatggcgataagcatgcttagaacttttactgaa
aaaggggggattgcgtttaattatacggaacttacaggttttactaaaagaaacggcaaa
atatctggtgctattattaaagatactattaatggtgaacaagtcattattaatagtaaa
tgcataataaatgcaacaggaatattcgcagacgagctcagaaaattagatgatactaat
gcaactaatattataaaaccttcccaaggaacacatttaataattaaaaaagacaaacta
cgtaccaagtacgcaatgcttatgcctacgacaagcgataagagagtcttattttctata
ccttggtatgatggtattatttgcggaagtacagatatttcaatagataaaattgaggaa
gaacccaaaagactagagagcgaaattgaattcataataaaaaatatgaataattactta
gatattaaaataacaaaaaatgatattctaagtgtttacacaggaattagacccttaata
atagatcccaagaaagaacaaaatacctcaaaaatatcaagaaacgagaaaatatttgta
tcagactcaaatctcattacaattgctggagggaaatatactacttgcagaaagatggct
gaaaaagttatacaaaaagcaatagacgcaaaattaatacctgattcaattcccaaaaca
gaaaatttaaagctgcacgggtatatagaaagggaagaagcacttaaaatccctgaacac
tttagagtttatgggagtgattttaaatatctaagtcaaatgaaagactttaataacaag
attcacaccgatttgccattaactgaagctcaaataacttttgccattgaatttgaacaa
gcaaaaactattgaagacattttatcaagaagaacaagatctctacttctcaatgcaaaa
gccacaattgaagctacaccaaaggtagctgagattatgatgcacaaacttggcaaatct
gaaaaatggaagaacgaacaaataaaaagctttaaagaagtagcaacaaaatatttagct
taa

DBGET integrated database retrieval system