KEGG   Bartonella henselae BM1374165: BM1374165_00442Help
Entry
BM1374165_00442   CDS       T03309                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
bhs  Bartonella henselae BM1374165
Brite
Enzymes [BR:bhs01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     BM1374165_00442 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CDO46463
UniProt: X5LSN8
LinkDB All DBs
Position
complement(510294..510896)
Genome map
AA seq 200 aa AA seqDB search
MAFELAPLPYDYDSLSPYMSRETLEYHHDKHHLAYLTNTNNFVKDLGLENESLENIVKKS
FGQNIGLFNNAAQYYNHNHFWHWMKKGGGGQKLPEKLAKAIESDLGGYDKFRADFIATAI
AQFGSGWAWIAVKDGKLEIMKTPNGENPLVHNAQPILGVDVWEHSYYIDYRNVRPKYLEA
FVDHLINWDYVLKLYEDCGL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaactagcacctttaccttacgattatgatagcctttcgccttatatgtca
cgcgaaacacttgaatatcatcatgataagcatcaccttgcttatctgaccaatactaat
aattttgtgaaagatttaggcttagaaaacgaaagccttgaaaatattgtaaaaaaaagc
tttggacagaatattggtttgtttaataatgcagcccaatactacaatcataatcatttt
tggcattggatgaaaaaaggagggggtggtcaaaaactacctgaaaaattagcaaaagct
atcgaatctgatttgggtggttatgataaattccgtgctgattttattgctactgccatt
gcacaatttggttctggatgggcatggattgctgttaaagatggtaaacttgaaattatg
aaaacgcctaatggtgaaaatcctctggttcataatgcgcaacctattctgggtgttgat
gtgtgggagcattcctactacattgactatcgcaatgtgcgtccaaagtatcttgaagcc
tttgtcgatcatttaattaattgggactatgttttgaaactttatgaagattgcggactt
taa

DBGET integrated database retrieval system