KEGG   Bartonella henselae BM1374165: BM1374165_00582Help
Entry
BM1374165_00582   CDS       T03309                                 

Gene name
gatB
Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
bhs  Bartonella henselae BM1374165
Pathway
bhs00970  Aminoacyl-tRNA biosynthesis
bhs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhs00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BM1374165_00582 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bhs03029]
    BM1374165_00582 (gatB)
Enzymes [BR:bhs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BM1374165_00582 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BM1374165_00582 (gatB)
Mitochondrial biogenesis [BR:bhs03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BM1374165_00582 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: CDO46601
UniProt: X5M3Z9
LinkDB All DBs
Position
674371..675870
Genome map
AA seq 499 aa AA seqDB search
MEIVDTRTPNSKRFISGVTGDWEVIIGMEVHAQIISNSKLFSGASTKFGAEPNNHVSLID
AAMPGMLPVLNQECVRQAVRTGLGLKARINLRSVFDRKNYFYPDLPQGYQISQFRYPIVG
EGKIIISIGPDSNGQFEDIEVGIERLHLEQDAGKSMHDQHPTMSFVDLNRSGVALMEIVS
KPDMRSADEAKAYMTKLRTIVRYLGTCDGNMDEGSMRADINVSVRRPGESFGTRCEIKNV
NSIRFIGQAIEYEARRQIAILEDGGVIDQETRLFDAAKGETRSMRSKEEAHDYRYFPDPD
LLPLEFDQAFVDALAAELPELPDDIKIRFINEMGLTAYDASILVTEKAIANYFEKVAHGR
DGKTVANWVINDLLGALNKDNREIEETPVSPDQLGSIIDLIKEGTISGKIAKDLFEIIWH
EGGDPRQIVEERNMKQVTDTKAIERAVDEIMANNSDKVAQAKQKPALAGWFVGQVMKTTG
GKANPQTVNELVKLKLGID
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgttgatacgcgtactcctaattctaagcgttttatttctggagttacaggt
gattgggaagtcatcattggcatggaagtccatgcgcaaattatatcaaattcaaaactt
ttttcaggtgcatcaaccaaatttggtgcggagccgaataatcacgtgtcacttattgat
gctgctatgcctggcatgttgcctgttcttaatcaagaatgtgttcgtcaagcagttcga
actggtttgggattaaaggcacgtattaatctgagatctgtttttgatcggaagaattat
ttttatccagatttaccgcaaggatatcaaatttctcaatttcgttatccgattgtcgga
gaggggaagattatcatatctattggtccggattcaaatggtcagtttgaggatattgaa
gttgggattgagagattacaccttgagcaggatgctggaaaatctatgcatgatcagcat
ccaacaatgtcttttgtggatcttaaccgttctggtgtcgctcttatggaaattgtttct
aaaccagatatgcgctcggcagatgaagctaaagcctatatgacaaaattgcgtacgatt
gttcgttatttgggaacttgcgatggcaatatggatgaaggttccatgcgtgcggatatt
aacgtatcagttcgtcgccctggtgagagttttggaacacgttgtgaaataaaaaatgtt
aattctattcgctttattggccaagcgattgaatatgaggcgcgccgtcaaattgcgatt
ttagaagatggtggtgttatagatcaagaaactcggctttttgatgctgcgaaaggggaa
acacgatctatgcgctcaaaggaagaagcgcatgattatcgttatttccctgatcctgat
cttttgccattggaatttgatcaagcatttgtggatgctttggcagctgaattgcctgaa
ttgcctgatgatataaaaatacgttttatcaacgagatggggttgacagcatatgatgct
tccattcttgtaacagaaaaagccattgctaattattttgaaaaagtagcacatgggcgt
gatggaaaaactgttgccaattgggtaattaatgatcttttgggtgctttaaataaagat
aatcgtgaaattgaagagacaccagtctcaccggatcagttgggaagcattattgatctt
attaaggaagggactatttctggaaaaattgccaaagatctttttgaaattatttggcat
gaaggtggggatccgcgtcagattgtggaagaacgcaatatgaaacaggtaacagataca
aaggctatagagagagctgttgatgaaattatggccaataattctgataaagttgcgcaa
gcaaaacaaaaacctgctttagcgggttggtttgttgggcaggtcatgaaaacaacaggt
ggtaaggcaaatcctcaaactgttaatgaattggttaaactgaaacttggtatagattaa

DBGET integrated database retrieval system