KEGG   Bacillus halotolerans: DIC78_18130
Entry
DIC78_18130       CDS       T06619                                 

Definition
(GenBank) PTS fructose transporter subunit IIB
  KO
K11195  fructose PTS system EIIB component [EC:2.7.1.202]
Organism
bht  Bacillus halotolerans
Pathway
bht00051  Fructose and mannose metabolism
bht02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIC78_18130
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    DIC78_18130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bht02000]
    DIC78_18130
Enzymes [BR:bht01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     DIC78_18130
Transporters [BR:bht02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    DIC78_18130
SSDB
Motif
Pfam: PTSIIB_sorb
Other DBs
NCBI-ProteinID: AZV51529
UniProt: A0A3T0LG37
LinkDB
Position
3535786..3536286
AA seq 166 aa
MNITLARIDDRFIHGQILTRWIKVHAADRIIVVSDDVAQDEMRKTLILSVAPSNVKASAV
SISKMAKAFHSPRYEGVTAMLLFENPSDIVSLIEAGVPIKTVNVGGMRFENNRRQITKSV
SVTEEDTEAFEILNELGVTLELRQLPSDTSEDFMEILRNVTKSSRG
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaacattacattggcaagaattgatgaccgctttattcacggccaaatcctgacaaga
tggattaaagtccatgcagcagaccgaatcatcgttgtgtcagatgacgttgcgcaggat
gaaatgagaaaaaccctgatcctatctgttgctccttccaatgtaaaggcgagtgccgta
tcaatttctaaaatggcaaaggcgtttcatagtccgcgctacgaaggggtaacggcgatg
ctgctgtttgaaaacccatccgatattgtatctctcatagaagcaggcgtccctatcaaa
accgtaaatgtcggagggatgcgttttgagaataatcgccggcaaatcaccaaatcagtc
agcgtaactgaagaggatacagaggcgtttgaaatattaaatgaattaggcgtcacactg
gaattgaggcagctgccttctgataccagtgaagactttatggagattttgagaaatgta
acaaaatcatcaaggggatga

DBGET integrated database retrieval system