KEGG   Bacillus halotolerans: DIC78_18135
Entry
DIC78_18135       CDS       T06619                                 

Definition
(GenBank) PTS mannose/fructose/sorbose transporter subunit IIC
  KO
K11196  fructose PTS system EIIC component
Organism
bht  Bacillus halotolerans
Pathway
bht00051  Fructose and mannose metabolism
bht02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIC78_18135
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    DIC78_18135
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bht02000]
    DIC78_18135
Transporters [BR:bht02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    DIC78_18135
SSDB
Motif
Pfam: EII-Sor TMEM251
Other DBs
NCBI-ProteinID: AZV50777
UniProt: A0A3T0LE66
LinkDB
Position
3536291..3537097
AA seq 268 aa
MTSIQIILLLIIAAITGIASVLDEGQTHRPLIACTLVGLVLGDLKTGIILGGTLELMALG
WMNVGLAMAPDTAIASVISTILVITADQGIGEGIAVAVALAAAGQALTIFVRTITVFFIH
RADKYAREGNIKGIEIMHVTAMVFQALRVMIPTLIVALISVSAVQVFLGNIPEVITKGLQ
IGGGIIVVVGYAMVINMMNIPYLKPFFYIGFLLAAFTDFNLVGFGALGLCLALLYQQVMQ
KNSAHGAVAAAADGSNAAVYDDDDDLDA
NT seq 807 nt   +upstreamnt  +downstreamnt
atgacttcaatacaaattattttgttgttaatcattgcagccattacaggtattgcaagt
gtattggatgaaggacaaacacaccgtccgctgattgcctgcactttggttggccttgtg
cttggtgatctaaaaacaggaatcattttaggaggaacgctggagctgatggcgctgggc
tggatgaatgtcggcctcgccatggcgcctgatacagccattgcctctgtgatttcaacc
attttagtgattaccgctgatcaaggcattggtgaaggcattgccgtcgctgttgctttg
gcagctgcaggtcaagcgcttactatttttgtccgaacgattactgtctttttcattcac
cgtgctgataaatatgccagggaggggaatatcaaaggaattgaaattatgcatgttacc
gccatggtgtttcaagcgctgcgtgtcatgataccgactttgattgtggccttaatcagt
gtgagcgctgttcaggtgttcttgggaaatattccggaagtcattaccaaaggtttgcaa
ataggaggaggcatcattgttgttgtggggtatgcaatggtgatcaatatgatgaatatc
ccttatcttaagccatttttctatattggttttttgttggcagcgtttaccgatttcaat
ttagtaggatttggcgctcttggtctctgtctggcgcttttataccagcaggttatgcaa
aaaaatagcgcccacggggcagtcgccgcagccgcagacggcagcaatgcagctgtctat
gatgatgatgacgatcttgatgcataa

DBGET integrated database retrieval system