KEGG   Bacillus halotolerans: DIC78_18140
Entry
DIC78_18140       CDS       T06619                                 

Definition
(GenBank) PTS mannose transporter subunit IID
  KO
K02771  fructose PTS system EIID component
Organism
bht  Bacillus halotolerans
Pathway
bht00051  Fructose and mannose metabolism
bht02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:bht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DIC78_18140
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    DIC78_18140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bht02000]
    DIC78_18140
Transporters [BR:bht02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Fructose-specific II component
    DIC78_18140
SSDB
Motif
Pfam: EIID-AGA
Other DBs
NCBI-ProteinID: AZV50778
UniProt: A0A3Q9RWV3
LinkDB
Position
3537118..3537945
AA seq 275 aa
MEKEKRLTKKDIFSMFIRSNFLLGSFNFERVQAMGYCYVMIPAIKKLYGPGAKRNAALQR
HLEWFNTHPWLSAPIFGVTAAMEEEMANNKGIDGKAISGMKIGLMGPIAGVGDPIFWGTV
RPVLAALGASLALGGNIAGPLLFFFLLNAIRLTTKYYGLKYGYVKGMEILQDLAGNRIQK
LTEGASILGLFVMGALVSKWTTINIPIVVSRIKDDNGKVDVQTVQNILDSIMPGVLPLGL
TLLVAWMLRKGVNPLLIIVGIFVIGILGYWAGFLA
NT seq 828 nt   +upstreamnt  +downstreamnt
ttggagaaagaaaaaagattaacaaagaaagacattttcagtatgtttatccgttcgaat
ttcttgctcggctcatttaactttgaacgtgtgcaggcaatgggatattgctatgtgatg
ataccggcgataaaaaaattgtacggtccgggagcgaaaagaaacgcagctttgcagcgc
catttggaatggtttaatacacatccgtggctgtccgcacccatatttggggtgacagct
gccatggaagaagaaatggcgaacaataaaggaatagacgggaaagcaataagcgggatg
aaaatcggtttaatgggtccgatagcgggtgtgggcgatcctattttctggggaaccgta
cgccccgtattggctgctttaggggcttctcttgctttaggcggaaacattgccggtcct
ctgctgttctttttcctgctgaatgccatcagattaaccacaaaatattacggtttaaag
tatggctatgtaaaagggatggagattctgcaggatctagcagggaatcgtattcaaaaa
ctgacagaaggtgcttccatcctcgggttatttgtgatgggggctttggtctccaagtgg
accaccatcaacatcccgatcgttgtttcaagaattaaagatgataacggaaaagttgac
gttcaaactgtgcaaaatattttagacagcattatgccgggggtgctgcctttaggattg
actttattagtggcatggatgctgcgaaaaggagtaaatccgctccttattatagttggc
atatttgtgatcggtattcttggctattgggctggatttctggcataa

DBGET integrated database retrieval system