KEGG   Butyrivibrio hungatei: bhn_I0669Help
Entry
bhn_I0669         CDS       T04542                                 

Definition
(GenBank) alpha-amylase Amy13D
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
bhu  Butyrivibrio hungatei
Pathway
bhu00500  Starch and sucrose metabolism
bhu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    bhn_I0669
Enzymes [BR:bhu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     bhn_I0669
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     bhn_I0669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF3459 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AOZ95703
UniProt: A0A1D9NZK8
LinkDB All DBs
Position
I:complement(761443..762978)
Genome map
AA seq 511 aa AA seqDB search
MPNWLKDAVFYEIYPQSFKDTNGDGIGDIAGIIEKLDYVKDLGCNALWINPIYDSPFKDG
GYDIRDYKKVAERYGTNEDAYRLFEVAHKKGIHVLLDLVPGHTSEEHPWFQESKKAEENE
YTDRYVWTKCWFHGIAGHPYVGGEADRDGCYMLNFFKCQPALNYGFLNRTEEWQLPPDHP
ACIATREAMKDIMRFWLDHGCDGFRVDMADSLVKDDDENKSATGKIWRNIREMLDKEYPE
AAIISEWSNPWQALKNGFHSDFYLDHQGNGYNTLLRDYETEGGDHSFLKKDGQGDIIRFL
NDYLPKYNDTKDDGYISFITCNHDTPRPARTLSPAELKIAYAMFLTLPGVPFIYYGDEIG
MKYLDIPTKEGGYTRTGTRTPMQWDSSKNYGFSDASEDKLYLPQDKSVDAPTVEAQLSDE
TSLLSEVKRLIALRHEYADLQADGSFEVVFAQKDQFPFVFKRGDLIIGINPSDKAVSLKL
PVKGEIIHKIGNVSFDREELKMDAQTFVVIK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcctaactggttaaaagatgcagtattctacgagatttatcctcaatcattcaaagat
acaaatggcgatggtatcggtgatatcgccggcatcattgagaaacttgattatgtaaag
gatcttggctgcaatgcactttggatcaatcctatctacgactctccttttaaggacggt
ggctacgacattagggattacaagaaggttgcagagcgctatggaactaatgaagacgcg
tacagactctttgaggtcgctcacaagaagggcattcatgtgctccttgaccttgttcct
ggacacacttcagaggaacatccatggtttcaggagagcaaaaaagctgaggaaaatgaa
tatacagaccgctatgtgtggacaaaatgctggttccacggaatagctggtcacccatat
gttggcggtgaggccgatagagatggctgctacatgctcaatttctttaaatgccagccc
gctcttaactacggttttctcaatagaactgaggaatggcagcttccacctgatcaccca
gcatgtattgcgactagagaggccatgaaggacatcatgagattctggctggaccacgga
tgcgacggtttccgcgtggatatggctgattctctggtaaaagacgatgatgagaacaag
tcagctactggaaagatctggagaaacatcagagagatgcttgataaggaatatccagaa
gcagccattatttcagagtggtcaaatccttggcaggctcttaaaaacggcttccactca
gacttttatcttgatcatcagggaaatggctacaatactcttctgcgcgactacgagaca
gagggtggtgatcatagcttcctcaaaaaagatggtcagggcgacatcatacgcttcttg
aacgactatcttccaaagtacaatgataccaaggacgacggttacatcagcttcattacc
tgtaaccacgacacaccaagacctgcaagaactctttctcctgcagagcttaagatagca
tatgctatgtttttgacacttcctggtgttccatttatttactacggtgatgaaattgga
atgaagtatcttgatatccctactaaggagggcggttacaccagaaccggcaccagaact
ccaatgcagtgggatagttctaagaactatggcttctcagatgcttctgaagataagctc
tatctcccacaggataagagcgtagatgctccaactgttgaggcacagctatctgacgag
acatctcttttatcagaggttaaaagacttatcgctctccgtcatgaatatgcagacctt
caggcagatggctcatttgaagttgtatttgctcagaaagatcagttcccatttgtattt
aagcgaggagatttgatcataggaatcaatccttcagataaggctgtatcacttaagctt
cctgtaaagggtgagatcatccacaagattggtaatgtgtcttttgacagagaagagctc
aagatggatgctcagacatttgttgtaataaaataa

DBGET integrated database retrieval system