KEGG   Butyrivibrio hungatei: bhn_I2424
Entry
bhn_I2424         CDS       T04542                                 

Definition
(GenBank) pseudaminic acid CMP-transferase PseF
Organism
bhu  Butyrivibrio hungatei
SSDB
Motif
Pfam: CTP_transf_3 Orn_Arg_deC_N Orn_DAP_Arg_deC NTP_transf_3
Other DBs
NCBI-ProteinID: AOZ97456
UniProt: A0A1D9P4B8
LinkDB
Position
I:complement(2763250..2765178)
AA seq 642 aa
MSCVAIITARGGSKRIPGKNIKNFCGKPIIEYSITAAIESGAFDEVMVSTDDEKIAEVAR
NAGAKVPFMRSEDTANDYATTDEVIAEVLNRYKSEGKIFDRFCCIYPTAPFITPQRLKEA
MDKLDEHESVTPVVAFSYPPQRGFIIENERLVRKHLEHALTRSQDLEKIYHDSGQFYACR
TDAFFRDNTTDVDDMVAVILSEDEVQDIDTFEDWKIAEQKYRNLKSASEEMTNMSGEKFD
DSKLKTPYYRVDESLLNADIKMLKDALNKDWNNYICSYSVKTNSLPWLLAHLKENGFYAE
VVSKEEYELALRLGYRKDQVIYNGPIKDKDAFCEILLAGGIVNMDSSYEPLWLEELANKH
KDRSFGIGIRVNYDISTIIPDEVLADEEGSRFGYCYENGELGKVIDKVKSFPNVKVAGLH
LHSSTKSRSLNAYRALSQVAVLVAKEYELDLDYVDMGGGYYGGVEGKPDFRSYVPAISEE
LSKFFDVNKTKLVMEPGVSMVSSSFSFVTSVIDTKDIREHRYVVIDGSRVNLNPQVTRRW
YPHRFEYAGDKASRNKMDSQMICGATCMEYDRLFNAENEVELKTGDKVVFTNAGGYTLCL
TPLFIHYFPAVYVKKSDGTVFEARFPWTNEEYMMKNHFQGGF
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgagctgtgttgccattattacagccagaggcggaagtaagagaatccctggcaagaac
ataaagaatttctgtggaaaacctattatcgagtattctataacagccgctattgaaagc
ggcgcattcgatgaagtaatggtttcaacagatgatgagaagattgccgaggttgctagg
aatgctggagccaaggttcctttcatgcgctcagaggatactgccaatgactatgctaca
acagatgaagttattgcagaagtactgaatagatacaagtcagaaggcaagatttttgac
agattctgttgtatatatcctacagctccttttattactcctcagagattaaaagaagct
atggataaacttgatgagcacgaatcagttactccagtggttgctttttcatatccacct
cagaggggctttatcattgaaaatgagagacttgttcgtaagcatcttgagcatgctctc
acaagatctcaggatcttgaaaagatatatcacgacagtggacagttctatgcctgcagg
acagatgctttctttagagacaatacaactgatgtagatgatatggttgctgttatcctt
agcgaagatgaagttcaggacattgatacctttgaagactggaagattgctgagcaaaaa
tacagaaatcttaagagtgcgtcagaagaaatgacaaacatgtcaggcgaaaagtttgat
gattcaaagctcaagactccttattacagagtggatgaatctcttttaaatgctgatatc
aaaatgctaaaagacgcactgaataaggattggaataattacatctgttcttattcggtt
aagactaactcacttccatggcttcttgctcatttaaaggaaaatggcttttatgcagaa
gttgtttccaaggaagaatatgagctcgctcttagactaggctatagaaaagatcaggtg
atctataatggaccaataaaggataaggatgctttctgtgagattctccttgcaggtgga
atcgtaaatatggattcaagctatgaaccactttggcttgaagaacttgctaataaacat
aaagacaggtcttttggtattggtatcagagtcaactatgatatctctactattattcct
gacgaagttcttgcagacgaggaaggaagtagatttggctactgctacgaaaatggtgag
cttgggaaagtcattgataaagtgaagagctttccaaatgttaaggttgctggtcttcac
cttcattcttctacaaagtcacgttcacttaatgcctatagagctctttctcaggttgct
gttctagtggcaaaagagtatgagcttgatcttgactatgtggacatgggcggcggatat
tatggcggcgtagaaggtaagcctgattttagaagctacgttcctgcaatcagtgaggaa
ctttcaaagttctttgatgtgaataagacaaagctagtaatggagccaggtgtatctatg
gtttcatcttcatttagttttgtaacgagtgttattgatacaaaagatatcagagaacat
agatatgttgtaatagacggaagccgtgtgaatcttaatccacaggttaccagaagatgg
tatcctcacaggtttgagtatgccggcgataaggcttctagaaataagatggattcgcag
atgatctgtggtgccacatgcatggagtacgacagattgtttaatgcagaaaatgaggta
gagctcaagactggtgacaaagttgtatttactaatgccggaggatacacgctttgcctt
acacctcttttcatacattattttccagcggtttatgttaaaaagagtgatggaacggtt
tttgaagccagatttccatggactaatgaagaatacatgatgaagaatcatttccaggga
ggtttttaa

DBGET integrated database retrieval system