KEGG   Brachyspira hyodysenteriae WA1: BHWA1_02402Help
Entry
BHWA1_02402       CDS       T00865                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
bhy  Brachyspira hyodysenteriae WA1
Pathway
bhy00500  Starch and sucrose metabolism
bhy01100  Metabolic pathways
bhy01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhy00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BHWA1_02402
Enzymes [BR:bhy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BHWA1_02402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth EBA-175_VI
Motif
Other DBs
NCBI-ProteinID: ACN84856
UniProt: C0QXJ0
LinkDB All DBs
Position
complement(2705479..2708040)
Genome map
AA seq 853 aa AA seqDB search
MKLNKYMVSPSVPKELEPLIEITKNFWWCWNQKAVTLLRTIDIDNWDKRDHNPIRVLGES
LQERFDAMLQDDAAMMNLAEVYDEFKTYMNQETWYNSLNENQKTNNEKIAYFSFEYGLHE
SLPNYSGGLGILSGDHLKSASDLGLPLVAVGLLYRKGYFRQYLNADGWQQEYDIENDFFN
LALEKVLDKNGETMKVDVDLPGRKVYAQIWKANVGRIELYYLDANIEENSVADRDITAQL
YGGNLETRIQQEILLGIGGVKALDKLGIKPTIYHMNEGHSAFLSLERIRQLMENNHLDKN
TAREVVFSSNIFTTHTPVPAGNDIFPIDMVQKYFTDYVKHIDMTMDEFIRLGRINPDDQK
ESFCMTVLALNLSAENNGVSELHGHVSRSMWKDIWKGVPVNELPIDSITNGIHTLSWISF
DMQNLLDRYLGPRWRTKPLEYNIWERVQKIPDAELWRTHERRKERLIDFCRERLKTQITN
RGFTKNEIEHADQILSPEALTIGFARRFATYKRGTLLFRDLERLKKIVTNSERPVQIIFA
GKAHPHDNGGKELIRNIAEICRREDFRDHIVFIEDYDINVARYMVQGVDVWLNNPRRPLE
ASGTSGMKVPPNGGLNFSVLDGWWDEAYDGQNGWPIGNREEYTDLEYQDEVESKALYNVL
ENEIIPLFYDRGRDNIPRQWVAAMKWSMQTVCPVFSTNRMVADYFHKFYNNASKRYFNMT
ENEFAKAKELKAWKQDIASKWSKVLIENTISEMPSRNLKVGSKFEVKTIVNLGDIAPDSV
RVELYHGKLSMKEEIIDPITVEMKHSADLGNGRHSFSGTLECTDSGQSGYAIRMYPYHKD
LSYKFDMKLIIWS
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaaataagtatatggtttcaccatcggttccaaaagaattagaaccacttata
gaaattactaaaaacttttggtggtgttggaatcagaaagcagtaactttattaagaaca
atagatattgataattgggataagagagatcataaccctataagggtattaggagaatct
cttcaggaacgttttgatgctatgcttcaagatgatgcggctatgatgaatttggctgag
gtttatgatgagtttaaaacttatatgaatcaagaaacttggtataatagcttaaacgaa
aatcaaaaaactaataatgaaaaaatagcttatttctcttttgaatacggacttcatgaa
tctttacctaactattctggaggtcttggtatattatctggagaccatttaaaatctgca
agcgatttgggtttgcctttagtagctgtaggacttttatatagaaaaggttatttcaga
cagtatttaaatgctgatggttggcagcaggaatatgatatagaaaatgatttctttaac
ttagctttagaaaaagttttagataaaaacggtgaaacaatgaaagttgatgttgatttg
cctggaagaaaagtttatgctcaaatctggaaagctaatgtaggaagaatagaactttat
tacttagatgctaatatagaagaaaatagtgtggcagacagagacattactgctcagctt
tacggcggtaacttagaaactagaatacagcaggaaatacttcttggtataggcggtgtt
aaagcattagataaattaggaattaaacctactatttatcatatgaatgaaggacacagt
gctttcctttctctagaaagaataagacaattaatggaaaataatcatttagataaaaat
actgcaagagaagttgtatttagctctaatatatttacaactcacactcctgtacctgct
ggtaatgatatattccctatagatatggttcaaaaatatttcactgattatgttaaacat
atagatatgaccatggatgaattcataagacttggaagaattaatccggatgatcaaaaa
gaaagtttctgtatgacagtacttgctttgaacttatctgctgaaaataatggtgttagt
gaacttcatggacatgtatcaagatctatgtggaaggatatttggaaaggcgttcctgtt
aatgaacttcctattgattctattactaatggtatacacactttaagctggatatctttt
gatatgcagaacttattagacagatatttaggacctcgttggagaactaagcctttagaa
tataatatttgggaaagagttcaaaaaatacctgatgcagaactttggagaactcatgaa
agaagaaaagaaagacttattgacttctgtagagaaagattaaaaactcaaataacaaac
agaggattcacaaaaaatgaaatagaacatgctgatcaaatactttctcctgaagcttta
acaataggttttgctagaagatttgctacttataaaagaggtacattgcttttcagagat
ttagagagattaaagaaaatcgttactaattctgaaagacctgtacaaataatatttgct
ggtaaagctcacccacatgataatggcggtaaagaattaattagaaatattgctgaaatc
tgcagaagagaagactttagagatcatatagtatttatagaagactatgatatcaatgtt
gctagatatatggttcaaggtgttgatgtatggcttaataaccctagaagacctttagaa
gcaagcggtacaagcggcatgaaagttccgccaaacggaggtttaaacttcagtgtatta
gacggatggtgggatgaagcttatgatggtcagaatggatggcctatcggtaacagagaa
gagtatactgatttagaatatcaagatgaagttgaaagtaaagctctttataatgtatta
gaaaatgaaataatacctctattctatgacagaggaagagacaatatacctagacaatgg
gttgctgctatgaaatggagtatgcagactgtttgtcctgtattctcaactaatagaatg
gttgctgattatttccacaaattctataacaatgcaagcaaaagatatttcaatatgact
gaaaatgaatttgctaaagctaaagaattaaaagcttggaaacaagatatagcttctaaa
tggtcaaaagttcttattgaaaacacaatttctgaaatgccttcaagaaatttaaaagtt
ggaagtaaatttgaagttaaaactatagttaatcttggagatatagcacctgattctgta
agagtagaactttaccatggtaagttaagcatgaaagaagaaatcatagatcctattaca
gttgaaatgaaacattcagctgatttaggaaatggaagacattctttctcaggaacttta
gaatgtactgacagcggacaaagcggttatgctataagaatgtatccatatcataaagat
ttaagttataaattcgatatgaaactcattatatggagctaa

DBGET integrated database retrieval system