KEGG   Bordetella hinzii: ACR54_00487
Entry
ACR54_00487       CDS       T04004                                 

Definition
(GenBank) hypothetical protein
Organism
bhz  Bordetella hinzii
SSDB
Motif
Pfam: DUF1525
Other DBs
NCBI-ProteinID: AKQ53839
UniProt: A0A0H4VZ51
LinkDB
Position
complement(496682..496942)
AA seq 86 aa
MLEADLADNLPTDPERASAIVQQRLKLGGTDLQRRIGTAYQGVADAWSLGVAKVPAIVVD
RRYVVYGETDVARAVSRIDQYRRTQP
NT seq 261 nt   +upstreamnt  +downstreamnt
gtgcttgaagctgacctggccgacaacctgcccaccgatcctgagcgcgccagcgccatc
gtccagcaacgcctgaagctgggcggtacagacctgcagcgaaggatcggcaccgcctac
cagggcgttgccgatgcctggagccttggcgtcgccaaggttccggccatcgtggtggat
cgccgatacgtggtctatggcgagacggacgtggcccgtgcggtttcccgcatcgaccaa
taccggaggacgcagccatga

DBGET integrated database retrieval system