KEGG   Bordetella hinzii: ACR54_01386Help
Entry
ACR54_01386       CDS       T04004                                 

Gene name
sodC1
Definition
(GenBank) Superoxide dismutase [Cu-Zn] 1 precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
bhz  Bordetella hinzii
Brite
Enzymes [BR:bhz01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACR54_01386 (sodC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu DUF4148
Motif
Other DBs
NCBI-ProteinID: AKQ54720
UniProt: A0A0H4VXJ9
LinkDB All DBs
Position
1412281..1412805
Genome map
AA seq 174 aa AA seqDB search
MKSLLQSALCAALLAAAAGAAAQTVDMYVDGPKGPQQKAGTIKIEQTKYGALLTPTLEGL
PPGVHGFHLHEKPSCDATMVDGKPVPMGGAGGHWDPDNTKAHKGPYDDSGHKGDLPALYV
TADGKATYPVLAPRLKASDFPGHALMIHAGGDNHSDHPLPLGGGGGRIVCGIVK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctctcctgcaatcagccctttgtgccgccttgctggcggcagccgcgggcgcg
gcggcccagaccgtcgatatgtatgtcgacggtcccaaggggccgcagcaaaaggcgggc
accatcaagatcgagcagaccaagtatggggccttgctgactcccaccctggaaggcctg
ccgccgggcgtgcacggctttcacctgcacgaaaaaccctcctgcgacgccaccatggtc
gacggcaagccggtgccgatgggcggggcgggcggccactgggatcccgacaacaccaag
gcgcacaaggggccctacgatgacagcgggcacaagggcgacctgcccgccctctacgtg
acggccgacggcaaggccacctacccggtgctggccccgcgcctgaaggccagcgacttc
cctggccatgccctcatgatccatgccggcggcgacaaccatagcgaccaccccttgccc
ctgggcggcggcggcgggcgcatcgtctgcggcatcgtcaaatag

DBGET integrated database retrieval system