KEGG   Bordetella hinzii: ACR54_02067Help
Entry
ACR54_02067       CDS       T04004                                 

Gene name
pphA_1
Definition
(GenBank) Phosphonopyruvate hydrolase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bhz  Bordetella hinzii
Pathway
bhz00440  Phosphonate and phosphinate metabolism
bhz01100  Metabolic pathways
bhz01120  Microbial metabolism in diverse environments
bhz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ACR54_02067 (pphA_1)
Enzymes [BR:bhz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ACR54_02067 (pphA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: AKQ55382
UniProt: A0A0H4VXY1
LinkDB All DBs
Position
2139467..2140339
Genome map
AA seq 290 aa AA seqDB search
MTRHQVLRQALREGRLFTAMAAHNPLSAVLAEQAGFDGIWGSGFELSASHAVPDASILPL
STHLDMMRAMAARVSVPVIADIDTGFGNAVNVAYVLPQFEAAGVSAVVMEDKHFPKDTSL
RERARQELVSIETFQGKVAAAVAARRDPDFVVIARVEALIAGLGQAEALRRASAYVEAGA
DAILIHSKQKTPDEILDFVRAWRGEAPLVLVPTAYPQLREADIAALRKVGVVIYGNHAIR
AAVGAMREVFARIRAEGGIAGVDAQLPTVNDIIALQGDAAMRELEKRFLR
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtcaccaggtattgcgccaggctttgcgcgaaggccggctgttcacggccatg
gcggcccataatcccctgtcggccgtgctggccgagcaggccggcttcgacggtatctgg
ggcagcggcttcgagctgtcggccagccacgccgtgcccgacgccagcatcctgccgctg
tccacgcatctggacatgatgcgggcgatggccgcgcgcgtgagcgtgcccgtcatcgcc
gacatcgacaccggcttcggcaacgccgtcaacgtggcctatgtgctgccgcagttcgaa
gccgccggcgtgtcggccgtggtcatggaggacaagcattttcccaaggacaccagcctg
cgcgagcgcgcgcgccaggagctggtgtccatcgagaccttccagggcaaggtcgcggcg
gcggtggcggcgcggcgcgatccggatttcgtggtcatcgcccgcgtcgaggcgctgatc
gccggccttggccaggccgaggccctgcggcgcgccagcgcctatgtcgaggcaggcgcc
gacgccattctcatccattccaagcagaagaccccggacgagatcctggacttcgtgcgc
gcctggcgcggcgaggcgccgctggtgctggtgcccacggcctacccgcagctgcgcgag
gccgatatcgcggcactgcgcaaggtgggcgtggtgatctacggcaatcacgccatccgg
gccgcggtcggcgccatgcgcgaggtcttcgcgcgcatccgcgccgaaggcggcattgcc
ggcgtggacgcgcaactgcccacggtcaacgacatcattgccctgcagggcgatgccgcg
atgcgcgagctggagaagcgttttctgcgctga

DBGET integrated database retrieval system