KEGG   Bordetella hinzii: ACR54_02625Help
Entry
ACR54_02625       CDS       T04004                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bhz  Bordetella hinzii
Pathway
bhz00061  Fatty acid biosynthesis
bhz00780  Biotin metabolism
bhz01100  Metabolic pathways
bhz01212  Fatty acid metabolism
Module
bhz_M00083  Fatty acid biosynthesis, elongation
bhz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ACR54_02625 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ACR54_02625 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bhz01004]
    ACR54_02625 (fabZ)
Enzymes [BR:bhz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     ACR54_02625 (fabZ)
Lipid biosynthesis proteins [BR:bhz01004]
 Fatty acid synthase
  Component type
   ACR54_02625 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydratas PS-DH 4HBT_3
Motif
Other DBs
NCBI-ProteinID: AKQ55940
UniProt: A0A0H4W178
LinkDB All DBs
Position
complement(2718752..2719207)
Genome map
AA seq 151 aa AA seqDB search
MELDIKGIMERLPHRYPMLLIDRVLEMVPGKSIVAVKNVSINEPFFNGHFPHHPVMPGVL
IVEAMAQASALFSFTDDNGGLKCEGSKTAYYLVGIDGARFRRPVVPGDQLRIEVEAERLS
RTICKYQGRALVDGQLVAEAKLMCAIRSLEE
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggaactcgacatcaaggggattatggagcgtctgccgcatcgctatccgatgctgctg
atcgaccgggtactggaaatggtgcctggtaaatccatcgtggccgtcaagaacgtctcc
atcaatgaacctttcttcaatggccattttccccatcaccccgtgatgccgggcgtgctc
atcgtcgaggcaatggcccaggcttcggccttgttttcgtttaccgacgacaacggcggc
ctgaagtgcgagggcagcaagacggcgtattatctggtgggtatagacggtgcgcgtttc
cgccgtccggtggtgccgggcgaccagctgcgcatcgaagtcgaagccgagcgcctgagc
cgcaccatctgcaagtaccagggacgggccctggtggatggacagctggtggccgaggcc
aaactgatgtgcgccattcgcagtctggaagagtaa

DBGET integrated database retrieval system