KEGG   Bordetella hinzii: ACR54_03939Help
Entry
ACR54_03939       CDS       T04004                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bhz  Bordetella hinzii
Pathway
bhz00473  D-Alanine metabolism
bhz00550  Peptidoglycan biosynthesis
bhz01100  Metabolic pathways
bhz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACR54_03939 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACR54_03939 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ACR54_03939 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhz01011]
    ACR54_03939 (ddl)
Enzymes [BR:bhz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ACR54_03939 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:bhz01011]
 Precursor biosynthesis
  Amino acid ligase
   ACR54_03939 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATPgrasp_ST ATP-grasp_4 TTL CPSase_L_D2 ATPgrasp_YheCD RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AKQ57225
UniProt: A0A0H4WGJ3
LinkDB All DBs
Position
complement(4170970..4171923)
Genome map
AA seq 317 aa AA seqDB search
MTQHFGKVGVLYGGRSAEREISLMSGAGVHEALRGAGVDAHLFDTGKQGLAELQSAGFDR
VFIALHGRYGEDGAIQGALELLNIPYTGSGVAASAVAMDKIMTKRIWLQHGLPTPAFEEI
DAKTELRLVPDRLGLPLILKPPHEGSTVGITKVAGYSDMKQAYASASHFDEVVLAEQFVR
GRELTVAVLGAGRGARALPVIEIVAPDGNYDYQNKYFTDDTKYYCPADLPEGVAAQVEEI
AVQAYRALGCEGWGRADFILDAQNRPWLLEMNTSPGMTSHSLVPMAARAVGMSYADLCVA
ILAEASCKLRAPARAKE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcatttcggaaaagttggcgtgctttacggcggccgttccgccgaacgcgag
atctcgctcatgtcgggggcgggcgtgcacgaagcactgcgcggcgccggcgtggacgcg
cacttgttcgataccggcaaacagggcctggccgagcttcagtcggccggttttgaccgc
gtattcatcgccttgcatgggcgctacggcgaagacggcgcgatccagggagcgcttgaa
ctcttgaacatcccctacacgggcagcggcgtggccgcctcggccgtggcgatggacaag
atcatgaccaagcgcatctggctgcagcatggcctgcccactccggcattcgaggaaatc
gacgccaagaccgagctgcgcctggtgcccgaccggctcggcctgccgcttatcctgaag
ccgccgcatgagggctcgaccgtcggcatcaccaaggtggccggttattccgacatgaag
caagcctatgcctcggcgtcgcacttcgacgaggtcgtgctggccgagcaattcgtgcgc
ggccgggagctgacggtggccgtgctgggtgcgggccgcggcgcgcgcgccttgcccgtc
atcgaaatcgtggcgcctgatggcaactacgactaccagaacaagtatttcaccgacgac
accaagtactactgcccggccgacctgcccgagggggtcgccgcgcaggtcgaagagatc
gccgtccaggcctatcgcgccctcgggtgcgaagggtgggggcgcgcggacttcattctc
gatgcgcaaaaccggccctggctgctggagatgaatacgtctcccggcatgaccagccat
tccctggtcccgatggccgcgcgcgcggtcggcatgagctatgccgacctctgcgtggcg
atcctggccgaggcctcttgcaagctgcgtgccccggcacgcgccaaagaatag

DBGET integrated database retrieval system