KEGG   Bordetella hinzii: ACR54_03946Help
Entry
ACR54_03946       CDS       T04004                                 

Gene name
penA
Definition
(GenBank) Penicillin-binding protein 2
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
bhz  Bordetella hinzii
Pathway
bhz00550  Peptidoglycan biosynthesis
bhz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bhz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACR54_03946 (penA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ACR54_03946 (penA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhz01011]
    ACR54_03946 (penA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bhz03036]
    ACR54_03946 (penA)
Enzymes [BR:bhz01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ACR54_03946 (penA)
Peptidoglycan biosynthesis and degradation proteins [BR:bhz01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ACR54_03946 (penA)
Chromosome and associated proteins [BR:bhz03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ACR54_03946 (penA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer DUF3490
Motif
Other DBs
NCBI-ProteinID: AKQ57232
UniProt: A0A0H4W3E5
LinkDB All DBs
Position
complement(4181099..4182832)
Genome map
AA seq 577 aa AA seqDB search
MKRVPFFDNPVLRGQLPMWRARLVLILLFAGLLVLAGRALFLQGLSNEFLQQQGERRYER
TLTLAATRGKILDRNNVVLASSVPARAIWAIPEDAKVATPEQINTLAKLLDTPAAELRRR
LTDEDRNFVYIKRQVPMDVADKVKQMALPGIHQQPESRRYYPEGEVTAHIVGFNNVEDQG
QEGVELTFNQQLSGRPGTRRVIKDRLGRVIEDVQAVTLPVDGRDLRLSIDTRLQYLVYKE
LQAALDKHQARAATAVVLDVHTGEILALANLPSYDPNRRENWKVATLRNQAITDTFEPGS
IMKPFTAALALDLGRITTSTTFDTGNGRFQYQGSTISDVSRNGVLDVAGVLRRSSNIGMT
MISEKLQAREMWDRFTELGLGQAPQLGFPGAAPGRLRPWDRWRLIEKATMAYGYGLSVSL
LQVARAYTVFARDGDMVSLTLVKRDSDPTSVKIYTPKTAGLIRAMLEAAAGPDGAKAAQV
QGYRVAGKSGTARKIVDGKYSLQRYRSSFVGFAPVSNPKVVVAVSIDEPQVGGYYGGAIA
APVFSSIVGGTLRLMGVQPDAPFESTIVAGVEGGGAR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgcgtgcccttcttcgacaatccggtgctgcgtgggcaattgcccatgtggcgt
gcgcgcctggtgctgatactgctgtttgccgggctcctggtgctggccggccgcgccctg
ttcctgcagggcctgtccaatgagtttctgcaacagcagggcgagcggcgctatgagcgc
accctgaccctggcggccacgcgcggcaagattctcgaccgcaacaacgtcgtgctggcg
tccagcgtgccggcgcgcgccatctgggccattcccgaggacgccaaggtcgccacgccc
gaacagatcaacacgctggccaagctgctggatacgccggccgccgagctgcgccgccgg
ctcacggacgaggaccggaatttcgtctacatcaagcgccaggtgccgatggatgtggcc
gataaggtcaagcagatggcgctgccgggcatacaccagcagccggaatcgcgccgttat
taccctgaaggcgaagtgaccgcccatatcgtgggctttaacaacgtcgaggatcagggc
caggagggcgtggagctgaccttcaaccagcagctctccggccgccccggcacccgccgc
gtgatcaaggaccggctggggcgtgtcatcgaggacgtgcaggcggtgaccttgccggtc
gacgggcgcgacctgcgcctgtccatcgatacccggctgcaatacctggtctacaaggaa
ttgcaggccgcgctggacaaacaccaggcgcgcgccgccacggccgtggtcctggacgtg
cataccggcgaaatcctggcgctggccaacctgccttcctatgatcccaaccggcgcgag
aactggaaggtcgccacgctgcgcaaccaggcgatcacggataccttcgagccgggttcc
atcatgaaacccttcacggcggccctggcgctggatctgggccgcatcaccacgtcgacc
accttcgacaccggcaacgggcgtttccaataccagggttcgacgatcagcgacgtcagc
cgcaacggcgtgctggatgtggccggcgtgctgcgccgctccagcaatatcggcatgacc
atgatttccgagaagctgcaggcccgcgaaatgtgggatcgcttcacggagttgggactg
gggcaagcgccgcagctgggcttcccgggcgcggcgccgggacgtctgcgtccctgggat
cgctggcgcctgatcgagaaggcgaccatggcctatggctatggcctgtcggtgtcgctc
ctgcaagtggcgcgcgcctatacggtgttcgcccgcgatggcgacatggtttccttgacc
ctggtcaagcgcgacagcgatccgaccagcgtgaagatctatacccccaaaaccgccggc
ctgatccgtgccatgctggaggccgcggccggccccgatggcgccaaggctgcccaggtg
cagggttaccgggtggccggcaagagcggcacggcgcgcaagatcgtggatggcaagtac
agtttgcagcggtatcgcagttctttcgtgggcttcgccccggtttccaatcccaaggtg
gtcgtggccgtctccatcgacgagccgcaggtgggcgggtattacggcggcgccatcgcc
gcgcccgtgttctccagcatcgtgggcggcacgctgcgcctgatgggcgtgcagcccgat
gcaccgttcgagtccaccattgtcgcgggtgtcgaaggcgggggggcgcgatga

DBGET integrated database retrieval system