KEGG   Bradyrhizobium icense: LMTR13_01165Help
Entry
LMTR13_01165      CDS       T04485                                 

Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabA
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
bic  Bradyrhizobium icense
Pathway
bic00061  Fatty acid biosynthesis
bic01100  Metabolic pathways
bic01212  Fatty acid metabolism
Module
bic_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LMTR13_01165
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bic01004]
    LMTR13_01165
Enzymes [BR:bic01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     LMTR13_01165
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     LMTR13_01165
Lipid biosynthesis proteins [BR:bic01004]
 Fatty acid synthase
  Component type
   LMTR13_01165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: ANW05186
UniProt: A0A1B1UR26
LinkDB All DBs
Position
complement(235369..235899)
Genome map
AA seq 176 aa AA seqDB search
MSDPRDFHAPQSSYTREDLLKSSEGGYFGPGNAQLPAQPMLMMDRIIEISVDGGEFGKGH
VIGELDITPELWFFDCHFRGDPVMPGCLGLDAMWQIIGYWLGWSGSPGKGRAVGVGEVKF
RGDIKPDVKRVRYEVSMRHVRRGKLAVGIANGRVFADDTCVYIARDMRVGLIATAI
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacccgcgcgactttcacgctccgcaatcgtcctacacaagagaggatctgctc
aagtcgagcgagggcggttatttcggcccgggcaatgctcagctcccggcacagccgatg
ctgatgatggaccggatcatcgagatcagcgtggacggcggcgaattcggcaagggccac
gtcatcggcgagctcgatatcacgccggagctctggttttttgactgtcactttcgcggc
gatccggtgatgccggggtgcctcggtctggacgccatgtggcagatcatcggctactgg
ctcggctggtcgggctcaccgggcaaaggccgcgcggtcggcgtcggcgaggtgaaattc
cgtggcgacatcaagccagacgtcaagcgcgtgcgctacgaggtcagcatgcgccacgta
cggcgcggcaaactggctgttggaattgcgaacggccgtgtgtttgccgacgacacatgt
gtctatatcgccagggatatgcgagtgggactgatagcgactgcgatctga

DBGET integrated database retrieval system