KEGG   Bradyrhizobium icense: LMTR13_06350Help
Entry
LMTR13_06350      CDS       T04485                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bic  Bradyrhizobium icense
Pathway
bic00630  Glyoxylate and dicarboxylate metabolism
bic00710  Carbon fixation in photosynthetic organisms
bic01100  Metabolic pathways
bic01120  Microbial metabolism in diverse environments
bic01200  Carbon metabolism
Module
bic_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bic_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LMTR13_06350
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LMTR13_06350
Enzymes [BR:bic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LMTR13_06350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ANV99851
UniProt: A0A1B1UAS5
LinkDB All DBs
Position
1331602..1332021
Genome map
AA seq 139 aa AA seqDB search
MRITQGCFSFLPDLTDEQISRQVQYCLENGWAVNIEFTDDPHPRNNLWEMWGLPMFDLRD
AAGVMMELNQCRKVYGNSYIRLSAFDSSHGWESVRLSFIVNRPKKEPGFRLERHEVAGRN
IRYTTRSYAADRPEGRRYG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacccaaggctgcttctcgtttctgcccgatctcaccgacgagcagatctcc
cgtcaggtccagtattgcctggagaatggatgggcggtgaacatcgaattcaccgacgat
ccgcatccccgcaacaatctctgggagatgtggggattgccgatgttcgatctccgcgac
gccgccggtgtgatgatggagctgaaccaatgccgtaaggtgtatggtaacagctacatc
cgcctgtcggcgttcgattccagtcacggctgggaatcggtgcggctgtccttcatcgtc
aaccgaccgaagaaggaacccggcttccgcctcgagcggcatgaagttgctggccgcaac
atccgctacacgaccaggtcctacgccgctgaccgcccggagggccggcgttacggttag

DBGET integrated database retrieval system