KEGG   Bradyrhizobium icense: LMTR13_06580Help
Entry
LMTR13_06580      CDS       T04485                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bic  Bradyrhizobium icense
Pathway
bic03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bic00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LMTR13_06580
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bic03400]
    LMTR13_06580
Enzymes [BR:bic01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LMTR13_06580
DNA repair and recombination proteins [BR:bic03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LMTR13_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ANW05352
UniProt: A0A1B1URC7
LinkDB All DBs
Position
1381281..1383953
Genome map
AA seq 890 aa AA seqDB search
MALKKLSTYRKKRDFGKTAEPSGDVKVAPARERRFVIQKHDASRLHYDLRLEFDGVFKSW
AVTKGPSLDPHDKRLAVEVEDHPLDYGDFEGTIPEDQYGGGTVMLWDRGYWVSDDPDRGF
KKGDLKFTLHGGKLHGSWVLVRMKGDRYGGKRTNWLLIKHRDEFVKEGEANDILDEDRSV
ASGRTMEQIAQGKGRAPKPFMLARKTKADAVWQSNRGDAAEARISRKTAALRAAPEIKTR
APAPTVRPKKVAAMPDFVAPQLCTVVERPPGGEGWCHEIKFDGYRVQLRVEGGDAVLYTR
KGLDWTDKFKAIAEEATSLPDVLIDGEIVALDHNGAPNFSTLQAALSDGDSESLIFYAFD
LLFAGGEDLRKLPLDDRKARLKKLLATQKGKDKQIRYVEHFESGGAAVLQSACKLELEGI
VSKKLNGPYRSGRTESWTKAKCRAGHEVVLGGWKTTNGKFRSLMAGVYRGDHLAFVGMVG
TGFGQDKVRRIMPALKAAASDKSPFGGKNAPKKARDVHWLKPELVAEIEFAGFTADGNIR
QAAFKGLRQDKPAEEVEAETPSTSGVAQPKPGKAAKAATKTRSARPAADKAAEVMGVVIS
KPDKEMWPDAGDGEPVTKLDLAKYFEAVGEWMIGHLKGRPCSIVRAPDGIHGEKFFQRHA
MQGMSNLLDLANVSGDRKPYVQIDRVEGLAAVAQIGGLELHPWNCAPNAYDTPGRLVFDL
DPAPDVEFAEVIEAAKDMRQRLTAVGLESFCKTTGGKGLHVVTPLLHGARDKVSWKEAKA
FAQGICQWMANDDPERYLLNMSKKLRKRKIFLDYLRNDRMSTAVAALSPRAREGATVSMP
LTWTQVRGDLDPKKYTIRTVPGLLSRTKAWDGYDDAAASIKPAIKKLAAK
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
gtggcgttgaagaaactcagcacgtaccgcaagaagcgcgatttcggcaaaacggcggag
ccttccggcgacgtcaaggtcgcgccggcccgagagcggcggttcgtgattcagaagcat
gacgcaagccggctgcattacgatctcaggctggaattcgacggcgtgttcaaatcctgg
gccgtcaccaaggggccgtcgctggatccccacgacaagcggctggcggtcgaggtagag
gaccatccgctggactacggcgatttcgaaggcaccattccggaagaccaatacggcggc
ggcacggtgatgctgtgggatcgcggctattgggtatcagatgatcccgaccgcggcttc
aagaagggcgacctgaaattcaccctgcatggcggcaagctgcatggaagctgggtgctg
gtgcggatgaaaggcgatcgctatggcggcaagcgcaccaactggctcctgatcaagcac
agagacgaattcgtaaaagaaggggaagccaacgacatcctggatgaggaccgttcggtc
gcgtcgggccgcacgatggagcagatcgcgcaaggcaagggcagggcgccgaagccgttc
atgctggccaggaagacgaaggctgacgcggtctggcagtcgaaccgtggcgacgcggcc
gaagcgcggatctcgcggaagacggccgccttgcgggccgcgccggagatcaagacgcgc
gcaccggcgccaacagtcaggccgaagaaagtcgcagcgatgccggatttcgtggcgccg
cagctttgcacggtggtcgagaggccgccgggcggcgagggctggtgccacgagatcaag
tttgacggctaccgcgtgcaattgcgggtcgagggcggcgatgccgtgctctatacccga
aaaggcctcgactggaccgacaagttcaaggcgatcgccgaggaagcgacatcgcttccc
gacgtgctgatcgacggcgagatcgtcgcgcttgatcataacggggcgcccaacttctcc
accctgcaggcggcgctgtcggacggcgacagcgaaagcctgatcttctatgcgttcgac
ctgttgtttgccggcggcgaggatctgcgcaagctgccgctcgacgaccgcaaggcgcgg
ctgaagaaattgctggcgacgcagaagggcaaggacaagcagatccgttatgtcgagcat
ttcgaaagcggcggcgctgccgtgctgcagtcggcctgcaagctcgaactggaagggatc
gtctccaagaagctcaacgggccctatcgctccggccgcacggaaagctggaccaaggcc
aaatgccgcgcgggacatgaggtggtgctgggcggctggaagaccaccaacggcaaattc
cgctcgctgatggccggcgtctatcgcggcgatcatctcgcctttgtcggcatggtcggt
accggtttcgggcaggacaaggtgcgccgcatcatgccggcgctgaaggcggcagcctcc
gacaagagcccgtttggcggcaagaacgcgccgaagaaagcccgcgacgtgcattggctg
aagcccgagctggtcgccgagatcgaattcgcggggttcaccgcggatggaaatatccgt
caggccgcgttcaagggcctgcggcaggacaagccggccgaggaggtagaggcagagacc
ccgtccacgtcaggcgtcgcgcagccgaagccgggaaaagcagcaaaagcggcgaccaag
accaggagcgcgcggcccgcagccgacaaagccgccgaagtcatgggcgtggtgatctcg
aagccggacaaggagatgtggcccgatgccggcgacggcgagccggtgaccaagctcgat
ctcgcgaaatatttcgaggccgtcggcgaatggatgatcggccatctcaaaggccgccct
tgctccatcgtgcgcgcgcccgacggcatccatggcgagaaattcttccagcggcacgcc
atgcagggcatgtccaacctgctggatctggccaacgtctcgggcgaccgcaagccctat
gtgcagatcgaccgtgtcgagggattggcagcggtggcgcagatcggcgggctggagctg
catccctggaattgcgcgcccaatgcctacgatacgccgggccggttggtgttcgacctc
gatcccgctccggatgtcgaatttgcggaagtgatcgaggcggcaaaagacatgcgccag
cggttgaccgccgttggcctcgaaagcttctgcaagaccaccggcggcaaggggctgcac
gtggtgacgccgctgcttcatggcgcaagagacaaggtctcgtggaaggaggccaaagcg
ttcgcgcaaggcatctgccagtggatggcgaacgatgatcccgagcgctatctgctcaac
atgtcgaagaagctgcgcaagagaaagatcttcctcgactatcttcgtaacgaccggatg
tcgaccgcggtcgccgcactgtcgccgcgtgctcgcgagggcgccaccgtctcgatgccg
ctgacctggacgcaggtgcgcggcgatctcgatccgaagaagtacacgatccgcacggtg
ccggggctgctgagcaggacgaaagcgtgggacggctacgatgacgcggcggcgtcgatc
aagccggcgatcaagaagttggcggcgaagtag

DBGET integrated database retrieval system