KEGG   Bradyrhizobium icense: LMTR13_07305Help
Entry
LMTR13_07305      CDS       T04485                                 

Definition
(GenBank) anthranilate synthase component I
  KO
K13503  anthranilate synthase [EC:4.1.3.27]
Organism
bic  Bradyrhizobium icense
Pathway
bic00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01130  Biosynthesis of antibiotics
bic01230  Biosynthesis of amino acids
Module
bic_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LMTR13_07305
Enzymes [BR:bic01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     LMTR13_07305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind GATase Peptidase_C26 Anth_synt_I_N PGM1_C
Motif
Other DBs
NCBI-ProteinID: ANW00015
UniProt: A0A1B1UB76
LinkDB All DBs
Position
1537512..1539677
Genome map
AA seq 721 aa AA seqDB search
MNRTAFSLPEHSEYRTAGGLVISRAVEQFTGNAKRLDDLIDLLDRRRGVVLSSGTTVPGR
YESFDLGFADPPLVLETAGSNFSLQALNARGEVLIAFLGNVLREPCVVISERSPTRLAGH
IIRGAAPVEEDQRTRRASVMSLVRDLVAAFTANDDPLLGLFGAFAYDLVFQIEDLVQKRA
READQRDIVLYVPDRLLAYDRATGRGVVLSYDFSWQGKSTQGLPRDTAESVYAKTPRQGF
ADHAPGEYQATVEVARAAFARGDLFEAVPGQLFAEPCERSPAEVFQRLCRINPSPYGALM
NLGDGEFLVSASPEMFVRSDGRRVETCPISGTIARGVDAIGDAEQIRQLLNSEKDEFELN
MCTDVDRNDKARVCIPGTIKVLARRQIETYSKLFHTVDHVEGMLRPGFDALDAFLTHAWA
VTVTGAPKLWAMQFVEDNERSSRRWYAGAIGAVNFDGSINTGLTIRTIRMKDGLAEVRVG
ATCLFDSDPAAEDRECQVKAAALFQALRGDAPKPLSTFAPDATGSGRKVLLIDHDDSFVH
MLADYFRQVGASVTVVRHVHAQEMLKRKGWDLLVLSPGPGRPEDFGISKTIGTALDRKLP
IFGVCLGVQAIGEYFGGQLGQLTQPAHGRPSRIQVRGGRLMQNLPNEIVIGRYHSLYVER
DSVPDVLEVTATTEDGVAMAIEHRTLPVGGVQFHPESLMSLGGEVGLRIVENAFRLNVPA
N
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggacagccttctccctgccggagcacagcgaataccggaccgccggcggtctc
gtgatttcgcgcgccgtcgagcaattcaccggcaacgccaagcgccttgacgacctgatc
gatctgctcgatcgccgccgtggcgtggtgctgtcgtccggcaccacggtgccggggcgt
tatgagagctttgacctcggctttgccgatccgccgctggtgctggaaacggccggctcg
aatttctcgctccaagcgttgaacgcgcgcggcgaggtgctgatcgccttcctcggcaac
gtgctgcgcgagccctgcgtcgtgatttcggagcgaagccccacgcggctggccggccat
atcatccgcggcgccgcgccggtcgaggaagaccagcgcacccgccgtgccagtgtgatg
tcgctggtgcgcgatctcgtcgccgcctttaccgcaaacgatgatccgctgctcggcctg
ttcggcgccttcgcctacgacctcgtgttccaaatcgaggatctcgtgcagaagcgggca
cgggaggccgaccagcgcgatatcgtactctacgtgccggatcgccttttggcctacgac
cgcgccaccggccgtggcgtggtgttgagctacgatttctcctggcagggaaagtctacc
cagggcctgccgcgcgacaccgctgagagcgtttacgccaaaacgccgcgccagggcttt
gccgatcatgcgcccggcgaatatcaggcaacggtcgaggtcgcacgtgcggcgttcgcg
cgcggcgacctgttcgaggcagtgccggggcaattgttcgccgagccctgcgagcgctcg
ccggcggaagtgttccagcggctctgccgcatcaacccgtccccctatggcgcgctgatg
aatctcggcgacggcgaatttttggtgtcggcctcgccggaaatgttcgtgcgttccgac
ggacgccgggtcgagacctgcccaatttcgggcaccatcgcgcgcggcgtcgatgcgatc
ggtgatgccgagcaaatcaggcagttgctgaactcggagaaggacgagttcgagctcaac
atgtgcaccgacgtcgaccgcaacgacaaggcgcgggtctgcatccccggcacgatcaag
gtcttggcgcggcggcagatcgagacctattcgaaactgttccacaccgtcgaccatgtc
gaaggcatgctgcgcccgggcttcgatgcgctggatgccttcctgacccatgcctgggcg
gtcaccgtgacgggtgcgccgaaattgtgggccatgcagttcgtcgaggacaacgagcgc
tcgtcgcggcgctggtatgccggcgcgatcggcgcggtgaatttcgacggcagcatcaac
accgggctcactatccggaccatccgcatgaaggatgggctggctgaagtgcgcgtcggc
gccacctgcctgttcgattccgatccggccgccgaggaccgcgagtgccaggtgaaggcg
gccgcgctgttccaggcgctgcggggcgatgcgccaaaaccgctgtcgacctttgcgccc
gacgccaccggctcgggccgcaaggtgctcttgatcgaccacgacgacagttttgttcat
atgctggcggactatttccggcaggtcggcgcaagcgtaaccgtggtccggcacgtccat
gcgcaggagatgctgaagcggaagggctgggatctcctggtattgtcgccgggcccgggt
cgccctgaggattttggaatctcgaagaccatcggaacggcgctggaccgaaaactgccg
atcttcggtgtctgtctcggcgtgcaggcgatcggcgagtattttggcggccagcttggc
cagctcacgcagccggcgcatggacggccgtcgcggattcaggtgcgcggcggacggctg
atgcagaacctgccgaatgagatcgtgatcggccgctatcattcgctctatgtcgagcgc
gacagcgtgcccgatgtgctcgaggtcaccgcgaccaccgaggacggcgtcgcgatggcg
attgaacacaggaccttgccggtcggcggcgtgcagtttcacccggaatcgctgatgtcg
ctcggcggcgaggtgggattgcgcatcgtcgagaatgcgtttcggctgaacgtacccgct
aattga

DBGET integrated database retrieval system