KEGG   Bradyrhizobium icense: LMTR13_13180Help
Entry
LMTR13_13180      CDS       T04485                                 

Definition
(GenBank) microcin ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
bic  Bradyrhizobium icense
Pathway
bic02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:bic00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LMTR13_13180
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bic02000]
    LMTR13_13180
Transporters [BR:bic02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    LMTR13_13180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_22 AAA_16 AAA_21 AAA Mg_chelatase AAA_29 AAA_5 DUF3987 NACHT PRK Zeta_toxin FtsK_SpoIIIE
Motif
Other DBs
NCBI-ProteinID: ANW00984
UniProt: A0A1B1UE00
LinkDB All DBs
Position
complement(2825935..2827542)
Genome map
AA seq 535 aa AA seqDB search
MTVVIKNLKLALPPGGDRAYAVDGVSFELSAGKILCVVGESGSGKSMCAHALMGLLPDTV
AAESGEILFEGKNLLSLSAAEWLAFRGRGIAMVFQEPMTALNPLMRIGEQIAEMFEAHGL
LTPKERQQKALALIREVGLPDPERAARAYPHQLSGGQRQRAMIAMALALEPAVLVADEPT
TALDVTTQAQILKLIRDLQRRRNMAVMFITHDFGVVAEIADRVVVLQHGKVVEQGTADDV
LLRAQHPYTRALLAAVPTLQPPQRTPLPDRSKAVEVIGLGKTYVSGGGWFRSERRVQAAK
DVSFDIYRGETLGLVGESGSGKSSVARLVMRLIEPDAGTVRIGDVDLTSIGGKALREQRR
RIQMVFQDPFASLNPRRKVGNIITDGPVAHGADPAAARKRAGELLSLVGLNASAMERFPH
EFSGGQRQRIGIARALALDPEILVADEAVSALDVSVQAQVLHLLEDLKARLGLSMLFITH
DLRVAAQICDRIAVMQRGSIVELKSASLLFAAPEHAYTRELLSAVPGQTSSSKAA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgtgatcaagaacctgaagctggcgctgccgccgggcggtgaccgcgcttac
gccgtggatggcgtgtcgttcgaactatcagccggaaaaatcctctgcgtggtcggcgaa
tccggctccggcaagtcgatgtgcgcccatgccctgatggggctgctgccggatacggtg
gcggccgaatccggagagattctgttcgaaggaaagaacctcttgtcgctgagcgcggcg
gaatggctggcgttccgtggccgcggcatcgcgatggtgttccaggagccgatgacggcg
ctcaatccattgatgcggatcggcgagcagatcgccgagatgttcgaagcgcatggccta
ttgacgccgaaggagcggcagcagaaagccctcgccttgatccgcgaagtcggcctgccc
gatcccgagcgcgcggcgcgcgcctatccccatcagctgtccggcggccagcgccagcgc
gccatgatcgcgatggcgctggcgctcgaacccgccgtgctggtggcggatgagccgacc
accgcgctcgacgtcacgacgcaggcgcagatcctcaaattgatccgcgacctgcagcgt
cgccgcaacatggctgttatgttcatcacccacgatttcggcgtcgtcgccgaaattgcc
gatcgcgtggtcgtgcttcaacacggcaaggtcgtcgaacagggcactgccgacgacgtg
ctgctccgcgcgcaacatccctacacccgcgcgttgctcgccgccgttcccacgctgcag
ccgccgcagcggacgccgctacccgatcgcagcaaggcggtggaagtaatcggcctcggc
aagacctatgtcagcggcggcggatggtttcgcagcgagcggcgcgtgcaagcggcaaag
gacgtcagcttcgacatctaccgcggcgaaacgctcggcctggtcggcgaatccggttcc
ggaaaatcgtccgtcgcccgcctcgtcatgcgcctgatcgaacccgatgccggcaccgtg
cgtatcggcgatgtcgatctcacctcgatcggcggcaaggcgctgcgcgagcagcgccgc
cgcatccagatggtgttccaggatccgttcgcctcgctcaatccgcgccggaaagtcggg
aacatcatcaccgacggaccggtcgcgcatggcgccgatccggcggcagcgcgaaagcgg
gccggcgagttgctcagcctcgtcggcctcaatgccagtgcgatggagcgctttccgcat
gaattctccggcgggcagcgccagcgcatcggaattgcgcgagcgctggcgctcgatccg
gagatcctggtcgccgacgaagccgtctctgcgctcgacgtctccgttcaggcgcaggtc
ctgcacctgctggaagacttgaaggcgcggctgggcctgtcgatgctgttcatcacccac
gatttgcgcgtagccgcgcagatctgcgaccgcatcgccgtgatgcagcgcggctcaatc
gtcgagctcaaatccgcctcgctcctgttcgcggcccccgagcacgcctacacgcgcgag
ctgctttccgccgtacccgggcaaacctcgtcgtcgaaggcggcatga

DBGET integrated database retrieval system