KEGG   Bradyrhizobium icense: LMTR13_14330Help
Entry
LMTR13_14330      CDS       T04485                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
bic  Bradyrhizobium icense
Pathway
bic00061  Fatty acid biosynthesis
bic00780  Biotin metabolism
bic01100  Metabolic pathways
bic01130  Biosynthesis of antibiotics
bic01212  Fatty acid metabolism
Module
bic_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LMTR13_14330
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LMTR13_14330
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LMTR13_14330
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bic01004]
    LMTR13_14330
Enzymes [BR:bic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LMTR13_14330
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LMTR13_14330
Lipid biosynthesis proteins [BR:bic01004]
 Fatty acid synthase
  Component type
   LMTR13_14330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ANW01172
UniProt: A0A1B1UEI0
LinkDB All DBs
Position
3075786..3076577
Genome map
AA seq 263 aa AA seqDB search
MNIPVFPETNVALKGKKGLIVGIANDQSIAWGCAKAFRALGADLAVTYLNEKAKKHVEPL
ASALESPIFMPLDVMVEGETEKVFERIEKEWGQLDFLLHSIAFSPKGALHGRVVDVDREG
FQKTMDVSCWSFMRMAHLAEPLMKNGGTIFTMTYYGSQMVVKNYNVMGVAKAALEAAVRY
IAAELGPKGIRVHAISPGPLATRAASGIPEFDELMDKAQSQAPTRSLVSIDDVGKATAFL
ALDGAKLITGSVLYIDGGYHIID
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcccggtttttcccgagaccaatgtcgcgctgaaaggcaagaagggtctgatc
gtcggcatcgccaatgaccagtccatcgcgtggggttgcgccaaggcgtttcgtgcgctg
ggcgctgaccttgcggtcacctatctgaatgagaaggccaagaagcacgtcgagccactg
gccagtgcattggaatcaccgatcttcatgccgctcgacgtcatggtcgagggtgagacg
gagaaggtattcgaacggatcgagaaggaatggggccagctcgattttctgcttcactcc
atcgccttctcgcccaagggcgcgctgcacggccgggtcgtggacgtcgaccgcgaaggg
ttccagaagaccatggacgtctcgtgctggtcgttcatgcgcatggcgcatttagcggag
ccgctgatgaagaacggcggcaccattttcaccatgacctattacggcagccagatggtg
gtgaagaactacaacgtgatgggggtcgccaaagccgcccttgaagccgcggtgcgctac
atcgcggccgagctcgggcccaagggcattcgcgtccacgccatttcaccgggaccgctc
gcgacccgcgcggcatcgggtatcccagagtttgatgaattgatggacaaggcgcagtcg
caggcgccgacgcgcagcctggtcagtatcgacgacgtcgggaaggcgaccgctttcctt
gcgctggacggcgccaagctgattaccggcagcgtgctctatatcgacggcgggtaccac
atcatcgattga

DBGET integrated database retrieval system