KEGG   Bradyrhizobium icense: LMTR13_16735Help
Entry
LMTR13_16735      CDS       T04485                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bic  Bradyrhizobium icense
Brite
KEGG Orthology (KO) [BR:bic00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bic03012]
    LMTR13_16735
   03029 Mitochondrial biogenesis [BR:bic03029]
    LMTR13_16735
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bic04147]
    LMTR13_16735
Translation factors [BR:bic03012]
 Eukaryotic Type
  Elongation factors
   LMTR13_16735
 Prokaryotic Type
   LMTR13_16735
Mitochondrial biogenesis [BR:bic03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LMTR13_16735
Exosome [BR:bic04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LMTR13_16735
  Exosomal proteins of breast cancer cells
   LMTR13_16735
  Exosomal proteins of colorectal cancer cells
   LMTR13_16735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ANW01568
UniProt: A0A1B1UFL9
LinkDB All DBs
Position
3589523..3590713
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKCDMVDDPELLELVELEVRELLSKYEFPGDKIPIIKGSALAALE
DKDKTLGHDAILELMRNVDEYIPQPERPVDQPFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGLRDTQKTIVTGVEMFRKLLDQGQAGDNIGALLRGTKREEVERGQVLAKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVHLPEGTEMVMPGDNIA
MEVHLIVPIAMEEKLRFAIREGGRTVGAGVVAAIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagcaaagtttgaacgtactaaaccgcactgcaacatcggaaccatcggtcac
gtcgaccatggcaagacatcgctgaccgcagcgatcaccaaggtgctggctgaaaccggc
ggtgcaacgttcacggcgtacgaccagatcgacaaggcgccggaagagaaggcgcgcggc
atcaccatctcgaccgctcacgtcgagtatgagacgaagaaccgccactacgcccacgtc
gactgccccggccatgccgactatgtgaagaacatgatcaccggcgccgctcagatggac
ggtgcgatcctggtcgtgtcggccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgtcaggtcggtgttcccgcgctcgtcgtgttcctgaacaagtgcgacatg
gtcgacgatccggagctgctcgagctcgtcgagctcgaagttcgtgaactgctctcgaag
tacgaattcccaggcgacaagatcccgatcatcaagggctcggcgctcgccgccctcgaa
gacaaggacaagacgctcggccacgacgcgatcctcgagctgatgcgcaatgtcgacgaa
tacattccgcagccggagcgtccggttgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcaccgtcgtcaccggccgtgtcgagcgcggcatcatcaag
gtcggcgaggaaatcgaaatcgtcggtctgcgcgacacccagaagaccatcgtcacgggc
gtcgaaatgttccgcaagctgctcgatcagggccaggccggcgacaacatcggcgcgctg
ctccgcggcaccaagcgcgaggaagtcgagcgtggccaggtgctggcgaagccaggttcg
gtcaagccgcacaccaagttcaaggctgaggcctacatcctgaccaaggaagagggcggt
cgtcacaccccgttcttcaccaactaccggccgcagttctacttccgcaccaccgacgtg
accggcgtcgtgcacctgcccgaaggcaccgagatggtgatgccgggcgacaacatcgcg
atggaagtgcacctgatcgtgccgatcgcgatggaagaaaagctgcgcttcgcgatccgc
gaaggcggccgcaccgtcggcgccggcgtcgtcgccgccatcatcgaataa

DBGET integrated database retrieval system