KEGG   Bradyrhizobium icense: LMTR13_18950Help
Entry
LMTR13_18950      CDS       T04485                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
bic  Bradyrhizobium icense
Pathway
bic00010  Glycolysis / Gluconeogenesis
bic00620  Pyruvate metabolism
bic01100  Metabolic pathways
bic01110  Biosynthesis of secondary metabolites
bic01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LMTR13_18950
   00620 Pyruvate metabolism
    LMTR13_18950
Enzymes [BR:bic01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     LMTR13_18950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: ANW01938
UniProt: A0A1B1UGP3
LinkDB All DBs
Position
4014656..4016173
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTAKAPFERRYGNYINGKWAEPRSGRYFENFSPVNGRLLCEVARSEAQDVEDA
LDAAHAAKEAWGRTSVAERALILNRIADRMEENLDLLALAETWDNGKPIRETTAADIPLA
IDHFRYFAGAIRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMACWKLAPALAA
GNCVVLKPAEQTPAAIMIWAGLIGDLLPPGVLNIVNGFGLEAGKPLASSPRISKIAFTGE
TSTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFAFNQGEVC
TCPSRALIHEKIFDRFMERALKRVEAIVQGDPLDPATMIGAQASSEQLHKILSYIDIGRG
EGAQVLTGGARNELPGDLAGGFYVKPTVFKGNNKMRIFQEEIFGPVVSVTTFKDDDEALA
IANDTLYGLGAGIWSRDASRLYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGVGRETH
KMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggtcgaattctcacggactgcgaaggccccgttcgaacggcgatacgggaac
tacatcaacggtaaatgggccgagccgcgctcgggtcgttatttcgagaatttctcgccg
gtcaacggccggctgctttgcgaggtcgcgcgctccgaagcgcaggacgtcgaagacgcg
ctcgacgcggcgcacgccgccaaggaagcctggggccgcaccagcgtcgccgaacgtgcc
ctgatcctgaaccgcatcgccgaccgcatggaggaaaacctcgacctgcttgcgctcgcc
gaaacctgggacaacggcaagccgatccgcgagaccaccgcggccgacattccgctcgcc
atcgaccatttccgctacttcgccggcgccatccgcgcccaggaaggcagcctttccgag
atcgatcacgatactgttgcctatcatttccacgagccgctcggcgtcgtcggccagatc
attccctggaacttcccgctgctgatggcgtgctggaagctggcgccggcgctggctgcc
ggaaactgcgtcgtgctgaagccggccgaacagaccccggcggcgatcatgatatgggcc
gggttgatcggcgacctgctgccgccaggcgtgctcaacatcgtcaacggttttggtctc
gaggccggcaagccgctggcgtcctcgccgcgcatctccaagatcgccttcaccggcgaa
acctcgacgggccggctgatcatgcaatatgccagccagaatctcattccggtgacgctc
gaactcggcggcaaatcgcccaacatcttcttcaaggacgtcgccgccgaggacgacgat
ttcctcgacaaggcgatcgaaggcttcgtgatgtttgcgttcaatcagggcgaggtctgc
acctgcccgagccgcgcgctgattcacgaaaagatcttcgatcgcttcatggagcgggcc
ttgaagcgggtcgaagcgatcgtgcagggcgacccgctcgatccggcgacgatgatcggc
gcgcaggcgtcttccgagcaactgcacaagatcctgtcctatatcgatatcggccgcggg
gagggcgcgcaggtgctgaccggaggggcgcgcaacgaactgccgggcgatctggccggc
ggcttctatgtcaagccgaccgtgttcaagggtaacaacaagatgcgcatcttccaggag
gaaatcttcggaccggtggtttcggtcacgaccttcaaggacgacgacgaagcgctcgcg
atcgccaatgatacgctctacggcctcggcgccggcatctggagccgcgatgccagccgg
ctctaccgcttcggccgcgccattcaggcgggccgcgtctggaccaattgctatcacgcc
tatccggcgcatgccgcattcggcggttacaaacaatcgggtgtcggccgcgagacccac
aagatgatgttagaccactaccagcagaccaagaacctcctggtcagctacagcccgaag
aagctcggcttcttctga

DBGET integrated database retrieval system